KEGG   Bdellovibrio bacteriovorus Tiberius: Bdt_2456Help
Entry
Bdt_2456          CDS       T02356                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bbat  Bdellovibrio bacteriovorus Tiberius
Brite
KEGG Orthology (KO) [BR:bbat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bdt_2456 (ahpF)
Enzymes [BR:bbat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Bdt_2456 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 Thioredoxin_3 FAD_oxidored DAO FAD_binding_3 Amino_oxidase Thi4 AlaDh_PNT_C NAD_binding_8 Ribosomal_L12_N NAD_binding_9 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AFY02139
UniProt: K7ZB67
LinkDB All DBs
Position
2590475..2592040
Genome map
AA seq 521 aa AA seqDB search
MLDSSLLEQLKSVFGALENTVELVYENSSHEDQKDLLDMLQSVASTSDKITLTQNASGTS
PMPQFRIDYKGKHTGIVFKGIPGGHEFTSLILAILNTDGKGKLLDSVIADRVRRLNKNIT
VQSYISLTCENCPEVVQALNQIALIHGSLRHEIIDGGYVQDDIKSLGIQGVPSLVANAKM
FHSGRIQLLDLVSKLESTFGVDANAAPSEPVNKNLGHFDVLVIGGGPAGASAAIYTVRKG
LSTAMITEKIGGQVQETKGIENLIGVTYTEGPALAAQLNQHIASYPVKVLENRRVKKIHT
ENKVKAIELESGEHLTADSIIVTTGAKWRELGVEGEKEYLGRGVAYCPHCDGPFYKGKKV
AVIGGGNSGVEAAIDLAGIVREVVVFEYNDQLKADKILVDKLKSLPNVSIVTSAKTEKVI
GDGSKVQQIQYLDRSLNKEEKMDLDGIFVQIGLVPNSQFLKETVELTKFGEIIVDEKGRT
SAKGIYAAGDVTTTPYKQIVIAMGEGAKAALAAFEDRMYHS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctagactcttctcttcttgaacaactaaaatctgtctttggcgccttggagaatact
gttgagcttgtctatgaaaacagctctcacgaggatcaaaaagatcttttggacatgctt
caaagtgtggccagcacatcagacaaaatcacgctgactcagaatgcgtctggcacttcg
ccgatgcctcagttccgtattgactacaaaggcaaacacacgggcatcgtgttcaaaggc
attcccggcggtcacgagttcacttcgttgattctggcgatcctgaatacggatggcaaa
ggcaagcttttggacagcgtgatcgcggaccgcgttcgtcgtctgaataaaaatatcact
gttcaatcttacatttctttgacctgcgaaaactgtcctgaagtggtgcaggctctgaat
cagatcgctttgattcacggaagtcttcgtcacgaaatcatcgacggtggctatgttcag
gacgacatcaagtccctgggcattcaaggcgtgccaagtctggtggcgaatgcaaaaatg
ttccactccggccgtattcagcttttggatctggtcagcaaactggaatccacctttggc
gtcgacgccaatgcagcaccatccgagcctgtgaacaaaaatctgggtcactttgatgtg
ctggtgatcggtggcggcccggcgggggcatccgctgcgatctatacagttcgcaaaggt
ctgtccacggccatgatcaccgaaaaaatcggcggtcaggtgcaggaaaccaaaggcatc
gaaaatctgattggtgtgacttacactgaaggcccggctttggcggctcaactgaaccag
cacatcgccagctatccggtgaaggttcttgaaaaccgtcgcgtgaaaaagatccacact
gaaaacaaggtcaaagccatcgaacttgaaagtggcgaacacctgactgcagattcgatc
atcgtcaccacgggggcgaaatggcgcgaactgggtgttgaaggtgaaaaagaatacctg
ggccgtggcgtggcttactgcccgcactgtgatggccccttctataaaggcaaaaaagtc
gctgtgatcggcggaggaaactcgggcgtggaagcggcgattgatctggccggcattgtt
cgcgaagtcgtggtgtttgaatacaacgatcagctgaaagccgacaagatcctggttgat
aaactgaagtcccttccgaatgtgtctattgtgaccagcgccaagactgaaaaagtcatc
ggtgatggctccaaagttcagcagatccagtatctggatcgttccctcaacaaagaggag
aaaatggatctggacggcattttcgtgcaaatcggcctggtgccgaacagccagttcctg
aaagaaaccgtggagctgaccaagttcggcgaaatcatcgtcgatgaaaaaggtcgcact
tcagccaaaggcatttacgctgccggagacgtcaccacgacgccctacaagcagatcgtg
attgccatgggtgaaggcgcgaaagcggcgctcgcagcctttgaagaccgtatgtatcac
tcttag

DBGET integrated database retrieval system