KEGG   Bacteroidetes bacterium: AEM51_01025Help
Entry
AEM51_01025       CDS       T04336                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bbau  Bacteroidetes bacterium
Brite
Enzymes [BR:bbau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AEM51_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMS25797
UniProt: A0A142L0Q1
LinkDB All DBs
Position
223139..223744
Genome map
AA seq 201 aa AA seqDB search
MSFELPKLPYEYTALEPHMDARTMEIHHSKHHNAYVTNLNNAIAGTDAEKLTIEEICKHI
SKYPAAVRNNGGGHYNHSFFWTILSGTPSSPSAKLEAAINADLGGMDKFKEEFNKAATTR
FGSGWAWLCVENGKLKVCSTPNQDNPLMDVVTDCNGTPVLGLDVWEHAYYLHYQNRRPDY
CTAFWNVVNWAEVSRRFEAAL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaactaccaaaattgccttatgagtacactgcactagagcctcatatggat
gctcgtactatggaaattcatcatagcaaacaccataatgcatacgttaccaatttaaac
aatgctattgccggaacagatgccgagaagctaaccattgaagagatttgtaaacacatc
agtaaataccctgctgcagtgcgcaacaacggtggtggtcattacaaccattcatttttt
tggaccatattaagcggaacgccatcgtctccttcagctaaactagaggctgccattaat
gctgatttaggtggaatggataagttcaaggaagagtttaacaaagcggcaacaacacgt
tttggttcgggatgggcttggttatgtgttgaaaatggaaagttgaaagtatgttcaaca
cccaaccaggataatccgttaatggatgttgtaacagattgtaatggaacacctgtttta
ggattagatgtttgggagcatgcatattatttgcactaccaaaaccgcagaccagattat
tgtacagcattttggaatgttgtgaattgggcagaagtaagccgcagatttgaggccgca
ttgtaa

DBGET integrated database retrieval system