KEGG   Bacteroidetes bacterium: AEM51_09290Help
Entry
AEM51_09290       CDS       T04336                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bbau  Bacteroidetes bacterium
Pathway
bbau00473  D-Alanine metabolism
bbau01100  Metabolic pathways
bbau01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbau00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AEM51_09290
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    AEM51_09290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbau01011]
    AEM51_09290
Enzymes [BR:bbau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AEM51_09290
Peptidoglycan biosynthesis and degradation proteins [BR:bbau01011]
 Precursor biosynthesis
  Racemase
   AEM51_09290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AMS27177
UniProt: A0A142L4N1
LinkDB All DBs
Position
complement(2083010..2085490)
Genome map
AA seq 826 aa AA seqDB search
MGYTIEHINKAIKSDFVQREGGSSWIEHLLMDSRKVVYPETSLFFAIKSERNDGHRYLQD
VYDAGVRNFIIEKDSIVSISILAQLKDANILSVSNSLTALQQLSAWHRSQFAIPIVGITG
SNGKTIVKEWLHQLLRDDVHIVRNPKSYNSQVGVPLSVWQLGEQHNLGLFEAGISKPGEM
ENLQRIIQPNIGIFTMLGEAHDEGFSDREEKLAEKFKLFTKADIVIACDEQPLVARKLEQ
FKQQHPNVKLYTWSRVNEHAQLYLQTIIQGNTTTIQSRSGSRILSVRIPFTDEASIENAC
TCFAFLMCLQRASTDILSRFEELQSVEMRMQLKEGINNCVVINDSYSSDLHSLRIALDFV
EQQSAGYKRTLIVSDILESGKEELELYTEVAKLIRQKGIQRLIGIGSIIAKHAMLFDSSA
VFYSDTKAFTEHFSAVDYANEIILLKGARKFQFEKIGKLLEKRVHETVMEINLNALVHNL
NVYRSKLKPGVKLMAMVKAFSYGAGSYEIAKVLEFNRIDYLTVAYADEGVILRKAGIKSP
IMVMNPEVSSFDTILEYNLEPEMYNFFILDQLVKAADGQEVSIHIEVDAGMKRLGFDEDQ
IETLISTLKKYPNIRIKSVFAHLAASEEKKHDEFTHQQITTYKRIAEQITDAFEYPILQH
ILNSSGIVRFPDAQFDMVRLGIGLYGIDPSVGLQKQLQPIGTLKTVVSQLRNVKAHETIG
YSRKGIVNKDSLIATVAIGYADGFNRKLGNGKGTMLVNGQRVPTIGSICMDMTMLDVTGM
DLKEGDEVIIFGNENDLNSVADKIGTIPYEVLTSISQRVKRVYYYE
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgggttacaccatcgaacacataaacaaggcaattaaaagtgatttcgtgcaacgcgaa
ggcggaagttcatggattgaacatttgttgatggatagtcgcaaggttgtgtatccagaa
acgagtttattttttgccatcaaaagtgaacgcaatgatggtcaccgttacctgcaggat
gtgtatgatgccggggttaggaatttcatcattgaaaaagattcgatagtttccatcagc
atcttggcgcagttaaaggatgcaaacatactttccgtatcaaattctttaacagcatta
caacaactttcggcttggcatcgatcacaatttgcaatacccattgtggggattacaggt
agtaatggaaaaacgattgttaaagagtggttgcaccaattgttacgtgatgatgtgcat
atagtgcgaaatccaaagagttataattcacaagtgggcgttccactttctgtttggcaa
ttgggcgaacaacataatttaggattgttcgaagccggtatttcaaaacccggtgagatg
gaaaacttacagcgaattattcaacccaatatcggaatatttaccatgctgggcgaggca
catgatgaaggtttttctgatagagaagaaaaattagctgaaaaattcaagttgtttacc
aaagctgatattgttattgcttgtgatgaacagccacttgttgctaggaagttggagcag
tttaaacagcagcacccaaatgtaaaactgtatacttggtcgcgggtaaatgaacacgct
cagttgtatttacaaacaattattcaaggtaacacaacaactattcaatcacgctcaggt
tctcgtattttgagcgttcgtattccctttacggatgaagcttctattgaaaatgcgtgt
acctgttttgcgtttttgatgtgtttgcaacgggcatcaaccgatatcctttctcgtttt
gaggagttacaatcggttgaaatgcgcatgcagctcaaagaaggaattaataactgtgtg
gtgataaacgatagttacagttccgacttacattccttgcgcattgctctcgattttgtg
gaacaacaaagtgctggctacaaacgaaccttaattgtttccgatattttggagtctgga
aaagaggagttggaattatacactgaagtagccaaacttatacgtcaaaaagggatacaa
cgtttgattgggataggttctattatagctaaacacgctatgttgttcgattcttcggct
gttttttattcagatacaaaagcatttaccgagcatttttctgcagttgattatgctaat
gaaattatattgcttaaaggagcaagaaaattccagtttgaaaaaattggtaagctactt
gaaaaacgagtgcatgaaacagtgatggaaattaacctaaatgcgctagtgcataatttg
aatgtataccgaagcaagttaaagccgggtgtaaagctcatggcaatggtaaaagcgttt
agttatggtgcaggcagttatgaaatagcgaaagtgttggagtttaaccgcattgattat
ctaacggttgcttatgcggatgaaggggtaattttacgtaaagccggaatcaaatcgcca
attatggtgatgaaccctgaggtatcgagttttgataccatactggaatataaccttgaa
cccgagatgtacaattttttcatactcgatcaactcgtaaaagcagcggatggccaagag
gtgagtattcacattgaagtggatgcgggaatgaaacgattagggtttgatgaagatcag
attgaaacgttgattagcacgttaaagaagtatccgaatattcgcatcaaatccgtgttt
gctcatttagcagcgagcgaagagaaaaagcatgatgagttcacccatcagcaaatcaca
acttataaacgcatagccgaacaaattactgatgcatttgagtacccaattcttcaacac
attttaaatagcagtggcattgttcgtttcccggatgcgcaatttgatatggtgcgtttg
ggaattggtttgtatggtattgatccttcagttggtttgcaaaaacaactgcaacctatt
ggcacactcaaaacagttgtatcccaattgcgaaatgtaaaagcacatgaaactattggc
tacagccgaaagggaattgttaacaaagactccctcattgcaaccgttgccatcggttat
gctgatggatttaatcgcaaactcggaaacggaaaaggaacaatgttggttaacggccaa
cgtgtaccaaccattggcagtatttgtatggatatgaccatgctggatgtaacaggtatg
gatctaaaagaaggagatgaggtaataatcttcggaaatgaaaacgacttgaatagtgtt
gccgataaaattggaaccattccttatgaagtattgacttcgatttcgcagcgtgtgaag
cgggtctattattatgagtaa

DBGET integrated database retrieval system