KEGG   Bacteroidetes bacterium: AEM51_11365Help
Entry
AEM51_11365       CDS       T04336                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
bbau  Bacteroidetes bacterium
Pathway
bbau00380  Tryptophan metabolism
bbau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AEM51_11365
Enzymes [BR:bbau01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AEM51_11365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AMS27527
UniProt: A0A142L5N1
LinkDB All DBs
Position
complement(2561265..2562551)
Genome map
AA seq 428 aa AA seqDB search
MQFENSLSFAQQLDKQDSLAKFRNEFHLLQKDGKPAVYLCGNSLGLQPKNVRAAIDQELK
DWADLGVEGHFDGKNPWMYYHHFLTEKAAKIVGAKPSEVVIMNNLTANLHLMMVSFYRPT
KTRYKIMMEVSAFPSDQYAMETQARFHGFNPEDAIIELKPREGEYTLRTEDIIATINANK
EELAIVMMGGVNYYTGQAFDMKTITKAAHAVGAIVGFDCAHAAGNLQLQLHDWDVDFAVW
CTYKYLNSGPGGTSGVFVHERHGNNPDLVRFAGWWGHDEKERFQMKKGFKPMEGAAGWQL
SNAQIFPMAIHKASLELFDEAGIENLRAKSEKLTGYLEFILNEVNGGLSGVEGKHFTIIT
PKTPAERGCQLSIIVKENGKKLFDYLNENGIMPDWREPDVIRMSPVPMYNSFEDVYRIGE
ALKQYFNH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgaaaactcattatcattcgcccaacaactcgataaacaggattcattagcc
aaattcagaaatgaatttcacctgcttcaaaaagatggtaaacctgctgtgtatttgtgt
ggaaattcattagggttacaacctaaaaatgtgcgtgcagccatcgatcaggaattaaag
gattgggccgatttgggtgttgaaggtcactttgatggcaaaaatccttggatgtattac
catcatttcttaaccgaaaaggcagcaaaaattgtgggtgccaaaccaagtgaggtagtt
atcatgaataacctcacggcaaacctacatttaatgatggtgagcttttaccgtcctaca
aaaacacgttataaaatcatgatggaagtgtccgcttttccaagcgaccaatatgccatg
gaaacacaagcgcgttttcatggatttaatccagaggatgccatcatcgaattaaaaccg
cgtgagggagaatacaccttgcgtaccgaagatattattgcaacgataaatgcgaataaa
gaggaattggccatagtaatgatgggcggtgtaaactattataccggtcaggcgtttgat
atgaaaaccatcaccaaagcagcacatgctgtgggagcaatcgttggttttgattgtgca
cacgcagccggaaatttgcaactgcaattgcatgattgggatgttgattttgccgtttgg
tgcacgtataaatatttaaattctggtccgggtggaaccagtggcgtatttgtgcatgaa
cgtcatggtaacaatccagatttggtacgttttgcaggttggtggggccatgatgagaag
gaacgcttccagatgaaaaaaggatttaaacccatggaaggtgcagcagggtggcaatta
agtaatgcccaaatttttccgatggctattcacaaagcatcattggaattgtttgatgaa
gcgggcattgaaaacctgagagccaagagtgaaaaattaacaggttatcttgagttcatt
ttgaatgaagtgaatggcggtctgagcggagtcgaaggcaaacatttcactattattact
cctaaaacccctgccgaaagaggatgccagctttctattattgtaaaagagaatggaaaa
aaattattcgattacttaaacgaaaatggtattatgcccgattggcgtgaaccggatgta
attagaatgagccccgtaccgatgtataattcgtttgaagatgtatatcgtattggagag
gcattaaagcagtatttcaatcactag

DBGET integrated database retrieval system