KEGG   Burkholderiales bacterium YL45: A4V04_08385Help
Entry
A4V04_08385       CDS       T04607                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bbay  Burkholderiales bacterium YL45
Pathway
bbay03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bbay00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    A4V04_08385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbay03400]
    A4V04_08385
Enzymes [BR:bbay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     A4V04_08385
DNA repair and recombination proteins [BR:bbay03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A4V04_08385
 Prokaryotic type
     A4V04_08385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ANU66431
UniProt: A0A1C7HGI4
LinkDB All DBs
Position
complement(1878277..1879029)
Genome map
AA seq 250 aa AA seqDB search
MNFSDVNRLKPGWGNLVEDFFDSSQGQGLISYVNKRKDEIGEDNVYPPDPLRALTLMSLD
EVRVVILGQDPYHGPNQANGLAFSVGEGIKLPPSLRNIFKEIINEYSGEMPSNGDLTYLA
KQGVLLLNASLTVEKGQPSSHSRIGWEILTDNLIRAVAKRQRPCVYLLWGSFAQQKRPII
EEISKPSSYLILQSNHPSPLSARRGPVPFIGCGHFKAANNWLEEKGEKPISWLPQENSKQ
KTEEKQLNLL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcggacgtaaaccggttgaagcccggatgggggaacctagtcgaagatttt
tttgattcttcccaaggacagggattaatttcatatgtgaacaagcggaaagacgaaatc
ggggaggataacgtttatcctccggatcctcttcgtgctttaactttaatgtctcttgat
gaagtcagagttgtcatccttggacaggatccctaccacggtccaaatcaggcgaatggt
ctggctttttctgtaggagaaggaataaaacttcctccgagtttgagaaatatctttaaa
gaaatcatcaatgaatattccggagaaatgccttcgaacggtgatttaacttatttagct
aagcaaggtgttcttttgttgaacgcgtctttgacagtagaaaagggacagccatccagc
cattctcgtatcggatgggaaatcctcacggataatcttatccgcgcggtggctaaaaga
cagcgtccgtgtgtttatctgttatggggaagctttgcacaacaaaagcgtccgattatt
gaggagatttctaagccctcttcttatctgattttacaaagcaaccatccttccccgctg
tctgcacgaaggggcccagttccttttatcggctgcgggcactttaaagcagctaataat
tggcttgaagaaaagggagaaaaacctatctcgtggcttcctcaagaaaattcaaagcaa
aaaacagaagaaaaacagttaaatttgctttga

DBGET integrated database retrieval system