KEGG   Burkholderiales bacterium YL45: A4V04_12145Help
Entry
A4V04_12145       CDS       T04607                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
bbay  Burkholderiales bacterium YL45
Pathway
bbay00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bbay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4V04_12145
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bbay01002]
    A4V04_12145
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbay01011]
    A4V04_12145
Enzymes [BR:bbay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A4V04_12145
   3.4.21  Serine endopeptidases
    3.4.21.-  
     A4V04_12145
Peptidases and inhibitors [BR:bbay01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   A4V04_12145
Peptidoglycan biosynthesis and degradation proteins [BR:bbay01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   A4V04_12145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 MRP-L47
Motif
Other DBs
NCBI-ProteinID: ANU67431
UniProt: A0A1C7HJA7
LinkDB All DBs
Position
2708181..2709788
Genome map
AA seq 535 aa AA seqDB search
MCLSAFALTCSLGGLANASAPTKEPQKNKKTAVSKKVAVPKKAVQPAKKNVKKNTVRTAL
TKAKKAVVPISAAAIPSALALSSGKTSSAVSELPSEISHAMLRARVDKNDLSIAVIPLGS
EGKKLLINANQPRIPASVEKIVTSAAALDLLGPSNVWSTYIASEAEPENGILKGNLYLIG
SGDPYLTIERFWLLLDNLRARGIKTIDGDIILDRSSFQVPAHDPFAFDGEGNRPYNLGPD
ALLINSRSLIIKFRPDPKKGVAYLYPEPILEGIKLPENIPLSKEVCGAWRKQINPDYSNP
YHPVFKGKYPSSCGAKNLMYTAFAQNEYVNAIFSSMWKQMGGEWKGTVKNGKAPEERTVL
ASSYSDPLTKLAYNMNKYSNNLIARQLFLALGKTAKDEPKNLAKSRETMKEWAQTLKISP
RELYLDNGSGLSRSSQLSAAAAARVLEYMWNHKVMAEYMASMPISGIDGTMKKRPVAKGQ
AHIKTGYISGVRSIAGYVLTASGKRYAVAAIINGNTAINAIPVMDAIIDWVYSEC
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttgtcggcttttgcattaacctgttctttaggagggcttgcgaacgcctctgct
cctactaaagagcctcaaaaaaataaaaagacggcagtatctaagaaagttgctgtgcca
aaaaaagctgtacagccagccaaaaaaaacgttaagaagaatacagtaagaacggcgttg
actaaggcaaaaaaggcggttgtaccaatatccgcggcggccattccttcagctttggct
ctttcttccgggaagacctctagtgcagtttcagaattgccttctgaaatttctcatgca
atgctaagggcccgcgtagataaaaacgatctttctatcgcggtcattccgcttggatct
gaaggtaaaaaacttttgatcaatgccaaccagccgagaatccctgcttccgttgaaaaa
atagtcacctctgctgcagctctggatttgcttggtccctcaaatgtttggtcgacgtat
attgcttctgaggccgagcccgaaaacggcatactgaaagggaacttgtatttgattggt
tccggagatccttacttaactattgagagattttggctgctgttggataaccttcgtgcc
cgaggaatcaaaaccattgatggtgacataatcctagatcgaagctctttccaagtgccg
gcacatgatccatttgcttttgatggagaaggcaatcggccttacaacctcggccctgat
gctctgctaattaactctcgctccttaatcattaaattcagaccagatccgaaaaagggc
gttgcttatctataccctgagccaatcctggaaggcatcaagcttcccgaaaatattccg
ctcagcaaggaagtttgcggagcttggcgaaaacaaattaatccggactactccaatccc
taccatccggtctttaaagggaaatatccatccagctgcggtgctaagaatttgatgtat
accgcctttgcgcaaaacgaatatgtgaacgcgattttctcctctatgtggaaacagatg
ggaggagaatggaagggaacggtcaaaaacggaaaagctccagaggaacgcaccgtcttg
gctagctcttattctgacccgctcaccaaacttgcctacaacatgaacaagtacagcaat
aatctgattgctcggcaattgttcttggcgttaggtaaaacagcaaaagatgagcccaag
aatttagctaaaagccgcgaaacaatgaaagagtgggcgcagactttaaaaatctcgccg
agagaactctatctggataacgggtcgggcctatctaggagctctcagctttcagcagcc
gctgccgccagagtacttgagtatatgtggaaccataaagtcatggctgaatacatggct
tccatgccgatttccggaattgacggaacaatgaaaaaacgccctgttgccaagggacaa
gctcacataaagaccggatatatctccggcgtccgctcgattgccggatacgtgctgacc
gcctcaggtaagcgctacgcggtagcagccatcatcaatgggaacaccgctatcaacgca
atacccgtaatggacgcgattatcgactgggtgtactctgagtgctag

DBGET integrated database retrieval system