KEGG   Bifidobacterium animalis subsp. lactis BB-12: BIF_00786Help
Entry
BIF_00786         CDS       T01840                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
bbb  Bifidobacterium animalis subsp. lactis BB-12
Pathway
bbb00550  Peptidoglycan biosynthesis
bbb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbb00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BIF_00786
Enzymes [BR:bbb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     BIF_00786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: ADC85217
UniProt: D3R393
LinkDB All DBs
Position
863336..864874
Genome map
AA seq 512 aa AA seqDB search
MTTRLTRGRHMADSGTSNANPVRTHAPWYGFATPFVGKSVRWASRLLHHGGSAFPGKVVE
RFDPTFLSRTLSTLPLGVVLVSGTNGKTTTTRMVATMLESLGLKVFTNPTGSNFTRGVVS
SILTEVPLNGRLDADIAVLELDEAYAVHFVEQVQPRYALLLNVMRDQLDRFGEIDNTARL
LGHVAAATRGTVVLNREDPRIARLRDVVKDGVRTRYFGLAEGLRHYFPADDDMTTTFQVQ
SADSAQAPEAADAQIVDVAHDVGTAHELHADVMLTKVGDHHAQMVIDGREYESDVKLEGV
YNLFNAAAALAVVRAVQADLRKPNAVGYAAAQLGRADSARARAFTARAHTFADADTDALF
AALADVTPAFGRGEVIDVNGSPVELLLVKNPMGFRLALASFPPESADTMIAINDQYADGR
DMSWLWDVDFTSLRPTGVAMVSGVRAWDMALRLEYDQVPVARVEPDLNAAVREFVNANPG
TPKHIYCTYTAMLAIRAELATVADVADAGVGK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgacgacacgattgacaagaggcaggcatatggcagattccggcacctccaatgcgaac
ccggtgcgcacgcacgcaccctggtatggctttgcgaccccgttcgtgggcaaatccgtg
cgctgggcctcgcgcctgctccatcacggcggcagcgcgttccccggcaaggtggtggaa
cggttcgaccccacgttcctgagccgcacgctgagcacattgccgctcggcgtggtgctc
gtctccggtacgaacggcaagaccaccaccacccgcatggtcgccacgatgcttgaatcg
ctgggtctcaaggtgttcacgaacccgaccggctccaacttcacgcgtggcgtcgtctcg
tcgatcctcaccgaagtgccgctgaacggccgcttggacgccgacatcgccgtgctcgaa
ctcgacgaggcctacgccgtgcacttcgtggagcaggtgcagccacgctatgcgctgctg
ctcaatgtgatgcgcgaccagctcgaccgtttcggcgagatcgacaacaccgctcggctt
cttggccatgttgccgcggcgacgcgcggtaccgtggtgctcaaccgagaggacccgcgc
atcgcacgcctgcgcgacgtggtgaaggacggcgtgcgcacccgctacttcggcttggcc
gaaggcctgcgccattatttccccgccgacgacgatatgaccaccacgttccaggtgcag
tccgcagactcggcgcaggctcccgaagctgcggatgcgcagatcgtcgacgtcgcgcac
gatgtcggcaccgcgcacgagctgcacgccgacgtcatgctcaccaaggtgggcgaccac
catgcgcagatggtgatcgacgggcgtgaatacgagtccgacgtcaagctggaaggcgtc
tacaatctgttcaatgcggccgctgcgctcgccgtggtgcgcgccgtgcaggctgacctg
cgcaagccgaacgcggtggggtacgcggccgcccaattggggcgtgcagattctgcccgc
gcccgcgcattcaccgcgcgcgctcacacattcgccgacgccgacaccgacgcgctgttc
gccgcgctcgccgacgtgacgccggcattcggccgcggcgaggtgatcgacgtgaacggt
tccccagtggagctgctgctcgtcaagaacccgatgggcttccgcctggcgctcgcctcg
ttcccgcctgaaagcgccgacacgatgattgcgatcaacgaccagtacgccgacggccgt
gacatgagctggctgtgggacgtcgatttcacgagtctgcggcccaccggcgtcgcgatg
gtgtccggcgtgcgcgcgtgggacatggcattgcgtttggaatacgaccaggtgccggtg
gcgagggtcgaacccgacctcaacgctgccgtgcgcgagttcgtcaacgcgaatccgggc
acgccaaaacacatctactgcacgtacacggccatgctcgccattcgtgccgagctcgcc
accgtggccgacgtggcggacgccggcgtgggcaagtag

DBGET integrated database retrieval system