KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0169Help
Entry
BLC1_0169         CDS       T01841                                 

Definition
(GenBank) putative phage infection protein
  KO
K01421  putative membrane protein
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Brite
KEGG Orthology (KO) [BR:bbc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BLC1_0169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 DUF3533 DUF1664 ABC2_membrane Apolipoprotein ApoLp-III Baculo_PEP_C BST2 phiKZ_IP Tropomyosin MscS_porin DUF4795 EzrA Prominin DUF3584 Phage_GP20 WXG100 DUF3829 Syntaxin_2 DUF2397 AIP3 SF-assemblin TBCC_N Leu_zip Bacillus_HBL Laminin_II Serine_rich
Motif
Other DBs
NCBI-ProteinID: AEN75952
LinkDB All DBs
Position
complement(204417..206615)
Genome map
AA seq 732 aa AA seqDB search
MSMLAKIFADDVRHLTSNIVSIIITIGLIVIPGLFTWFNVAACWDPFANTKNLQFAIAND
DEGYKGDLLPMRINIGEQVVDTLRANSQLDWTFTKSSAEAIDGTKSGKYYAAVVIPKNFS
KNMMTFFTDDAYHATLDYYNNEKLNALAPKVTGQGADTIAATINQTFSKTLTDTALNLAS
SMLDMLDKPEYQQRLKSFNGNIADLAGMLNDSAAVLRTYSSLTDSAKTLLASSNKLIADA
RASAKTGVDDLSAAKTGVSDLSGALGTSVNALGTAIDTSKTSLGSLNDRVDELFSAVDKQ
AGDTSAAINNLAGNVRTEATAYATTRGRLQELLDKSDNLGPVAKSAVQAFINRIGAVADD
LNQTADRLTTAANDVDSKVGSSKETRQEIKDLAGKAQSSVSSISKDFDETIKPDLTAMTN
AFSDAANSLNGTVSTLDSSLDSLSGTASDANKQLDSVHELIDNAATQLTDAAKELTNFNT
QFAKALDTGNMGTIKKLLSGNTATLSTALSTPVELKRVALFPVDTFGAALTPFYTFLPLW
VGALLLVVTLKIGISRKRQRELGNPKPWQIFLGHYGVFVSIALLQSTFSCAGTLLFLRVQ
VVHPWLFMLVGWFSSIVYSFFTYTLVSTFANVGKAIGVLFLVMQISGSNAAYPLSILPHF
ISDISPWLPVSYSVTAMRGAIAGIYENDYWIAMGKLALFLVPLLFIGLVLRHALLGFNHW
YEARVERTKLLG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgctcgcgaagatcttcgccgatgacgtgcggcacctcaccagcaacatcgtc
tcgatcatcatcacgatcggcctgatcgtgatccccggcctgttcacctggttcaacgtg
gcggcctgctgggatccgttcgcaaacacgaagaacctgcagttcgccatcgcgaacgac
gacgaggggtacaagggcgacctgctgcccatgcgcatcaacatcggcgagcaggtggtg
gacacgctgcgcgcgaactcgcagctcgactggacgttcacgaaatcgagcgcggaggcg
atcgacggcacgaaatcgggcaaatactacgccgccgtggtgattccgaagaacttctcg
aagaacatgatgacgttcttcaccgatgacgcgtaccacgccacgctcgactactacaac
aacgagaaactcaacgcgctcgccccgaaggtgaccggccagggcgccgacaccatcgcc
gccacgatcaaccagacgttctcgaaaacgctcaccgacaccgcattgaatctggcctcg
tccatgctcgacatgctcgacaagcccgaataccagcagcggctcaagtcgttcaacggc
aacatagccgacctcgcgggcatgctgaacgacagcgcggcggtactgcgcacatactcg
tcgctcaccgactccgcgaaaacgctgctcgccagctcgaacaagctcatcgccgacgcg
cgcgcatccgcgaaaacgggagtcgacgatctctccgccgccaaaaccggcgtgagcgac
ctctccggcgcgctcggcacgtcggtgaatgcgctcggcacggcgatcgacacctcgaaa
acgagtttgggcagtctgaacgaccgtgtggacgagctgttctcggcggtcgacaagcag
gccggcgacacgtctgcggcaatcaacaacctcgccggcaacgtgcgcaccgaggcgacg
gcgtacgcgaccacgcgcggcagactgcaggaactgctcgacaaatccgacaatctggga
ccggtggcgaaatccgccgtgcaggcgttcatcaaccggatcggcgcggtggccgacgac
ctcaaccagactgcagaccgtctcaccacagccgcgaacgacgtcgactccaaggtcggc
tccagcaaggagacccggcaggaaatcaaggatctcgcaggcaaggcgcaatcgtcggtc
tcgtcgatctccaaggacttcgacgagacgatcaagcccgacctcaccgcgatgacgaac
gcgttctctgacgcggcgaactcgctcaacggcaccgtcagcacgctcgactcctcactc
gacagcctatcgggcacggccagcgacgcgaacaaacagctcgactcggtgcacgagctc
atcgacaacgcggccacccagctcaccgacgccgcgaaggagctcacgaacttcaacacc
cagttcgccaaggcactcgacaccggcaacatgggcaccatcaaaaagctcctcagcggc
aacaccgccacgctgagcaccgcactgagcacgccggtggagctcaagcgcgtcgccctg
ttcccggtcgacacgttcggcgccgcgctcacgccgttctacacgttccttccgctatgg
gtgggcgcgctgctgctggtggtcaccttgaagatcggcatctcacgcaaacgccagcgc
gaactcggcaacccgaaaccatggcagatcttcctcggccactacggggtgttcgtctcg
atcgcgctgctgcagagcacattctcctgcgcgggcaccctgctcttcctacgcgtgcag
gtggtgcacccatggctcttcatgttggtggggtggttcagctccatcgtgtactcgttc
ttcacgtacacgctcgtctccacgttcgcgaacgtgggcaaggcgataggcgtgctgttc
ctcgtcatgcagatctccggttcgaacgcggcctacccgctctcgattctgccgcatttc
atcagcgatataagcccatggctgccagtgagctattcggtcaccgcgatgcgtggggcc
atcgccggcatctacgaaaacgactactggatcgccatgggcaaactcgccctgttcctc
gtgccgctgctgttcattggcctggtgctgcgccacgccctgctcggcttcaaccattgg
tatgaagccagggtcgagcgcaccaagctgttgggatga

DBGET integrated database retrieval system