KEGG   Bifidobacterium animalis subsp. lactis BLC1: BLC1_0238Help
Entry
BLC1_0238         CDS       T01841                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bbc  Bifidobacterium animalis subsp. lactis BLC1
Pathway
bbc00473  D-Alanine metabolism
bbc00550  Peptidoglycan biosynthesis
bbc01100  Metabolic pathways
bbc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BLC1_0238
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLC1_0238
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BLC1_0238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbc01011]
    BLC1_0238
Enzymes [BR:bbc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BLC1_0238
Peptidoglycan biosynthesis and degradation proteins [BR:bbc01011]
 Precursor biosynthesis
  Amino acid ligase
   BLC1_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEN76020
LinkDB All DBs
Position
297746..298882
Genome map
AA seq 378 aa AA seqDB search
MAKTRVAVLYGGKADEHSISCISAASFMRALDPELFEAVPIGITKTGTWFVDGQDPLGWN
LAEGLPEAVETPDSREVVLTIGDGGDGFHARNADGSLDSLGHIDVVLPALHGPFGEDGTI
QGLFEMMGVPYVGCGVLASAACMDKHYTKVLLRAAGIPVAPGITLDTRHYDASDEFATDG
EEFLRQVNEAGLQYPLFVKPSRAGSSFGVTKVEQIGDAAALAAAVFEASRHDWRVLVEQG
IDAREIECAVVRIHPTDPTRAALPGEVVLDRRSEGDDQFYDFDSKYMDSQASHTEIPAKI
GDDLIARVRETAVRAFDAVDGMGLSRVDTFVTADGDVLVNEINTLPGCTSISMFPQAWEA
MGIPFRTVVTDLIEGALA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacacgggtggcggttctctacggcggcaaggcggacgaacattcgatttcc
tgcatctccgcagcctcattcatgcgcgcgctcgaccctgaactgttcgaggccgtgccg
atcggcatcacgaagaccggcacctggttcgtagacggccaggatccgctcggttggaat
ctggccgaaggactccccgaggcggttgagacgcccgattcgcgcgaagtggtgctcacc
attggcgacggtggcgacgggttccacgcccgcaatgctgacggctcgcttgattcgctc
ggtcacattgatgtggtgctgcccgcactgcacggcccgtttggcgaggatggcacgatc
caaggcctgttcgagatgatgggcgtgccgtacgtgggctgcggcgtgctcgcctcggcc
gcgtgcatggacaagcactacaccaaggtgctgttgcgcgccgccggcattccggtggcg
ccgggcatcacgctcgacacccgtcactacgacgcctccgacgagttcgccaccgacggc
gaggaattcctgcggcaggtgaacgaggccggtttgcagtacccgttgttcgtcaaaccc
agccgtgccggctccagcttcggtgtgaccaaggtggagcagattggcgacgcagccgca
ctcgccgccgctgtgttcgaggcgagccggcatgattggcgcgtgctggtcgagcagggc
attgacgcgcgcgaaatcgagtgcgctgtggtgcgcattcacccgaccgacccgacccgt
gccgcgctacctggcgaagtggtgctcgaccggcgcagcgaaggcgacgaccagttctac
gatttcgacagcaaatacatggactcccaggcgagccacaccgagattccggcgaagatt
ggcgatgacctgatcgcgcgcgtccgcgagaccgccgtacgcgcattcgacgcggtggac
ggcatgggactgagccgtgtggacaccttcgtgaccgcagatggcgatgtgcttgtcaat
gagatcaacacactgccaggttgcacttcgatttcgatgttcccgcaagcgtgggaggcc
atgggcattccgttccgcaccgtggtcaccgacctcatcgaaggcgcgctcgcctga

DBGET integrated database retrieval system