KEGG   Belliella baltica: Belba_0572Help
Entry
Belba_0572        CDS       T02134                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bbd  Belliella baltica
Pathway
bbd00240  Pyrimidine metabolism
bbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Belba_0572
Enzymes [BR:bbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Belba_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Birna_VP4
Motif
Other DBs
NCBI-ProteinID: AFL83229
UniProt: I3Z1W1
LinkDB All DBs
Position
601581..602165
Genome map
AA seq 194 aa AA seqDB search
MFIEPFISIKNKKDKKGHIEVICGSMFSGKTEELIRRLNRALIAKQKVEIFKPSIDKRYH
ELDVVSHNENAIRSTPVNFAEDILLLAGDCDVVGIDEVQFFDNHIVHIANVLANGGKRVI
LAGLDMDFEGKAFEPMPQLLAIAEYVTKVHAICMKCGDLASYSYRLSDTKDKVMLGEKDS
YEARCRKCFYEEKN
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttatagagccgtttatcagtataaagaataaaaaagataagaagggtcacattgag
gtgatttgtggatcaatgttctcagggaagactgaagaactgattcgccgattgaaccgt
gccctgattgccaagcaaaaagttgaaatttttaagccgtccattgataaacgataccat
gaacttgatgtcgtctctcacaatgaaaacgccatccgatcaactccggttaactttgcc
gaagatatccttttgcttgcaggtgattgtgatgtggtaggaatagatgaggtacagttt
tttgataatcatatcgtgcatattgccaatgttcttgccaatggcggaaagagagttatt
cttgcaggtttggatatggattttgaaggcaaggcatttgagcctatgccacaactgctt
gctatcgcagaatatgtcacaaaggttcatgcgatatgtatgaaatgtggagatttggct
tcttattcttatagactttcagatacgaaagacaaagtgatgttgggagaaaaagacagc
tacgaggcaaggtgtagaaaatgcttctatgaagaaaaaaattaa

DBGET integrated database retrieval system