KEGG   Belliella baltica: Belba_0757Help
Entry
Belba_0757        CDS       T02134                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
bbd  Belliella baltica
Pathway
bbd00380  Tryptophan metabolism
bbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Belba_0757
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Belba_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DUF1134 Cys_Met_Meta_PP DnaB_2
Motif
Other DBs
NCBI-ProteinID: AFL83409
UniProt: I3Z2E1
LinkDB All DBs
Position
798030..799319
Genome map
AA seq 429 aa AA seqDB search
MSNQINFEYSLDFAQKMDEKDPLKSFRSKFFFPKVEDKEAIYFCGNSLGLQPKTTQNYIQ
KELSNWAEMAVDGHFHGEDAWYHIRKKSKPALAEIVGAHEHEVVAMNNLTSNLHFLMVSF
YRPNAKRFKIITEAGAFPSDMYMLETQVKFHGLDPNKAIVELAPRDGEHTLRTEDILQSI
KEQGEELALVMMAGLQYYTGQVFDMKAIAQAVKDEGAFVGFDLAHAAGNVPLALHDWGVD
FATWCSYKYMNSGPGNVSGIFVHENHAEKPDMIRFAGWWGHDEGERFKMEKGFKPMFGAD
GWQLANSNVLALAAHQASLDIFQQAGIKTLREKSETLTSYLEFLIQKISGNSGVLEIITP
KNINERGCQLSLLVHKGGKAVFDEFYKNGIVGDWRNPNVIRIAPTPLYNSYEDVFRFAKI
LEQSLQKFA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaaatcaattttgaatacagtttggattttgcccaaaaaatggatgaaaaa
gatccactcaagtcatttcggtcaaaatttttcttcccgaaagtagaggacaaagaagca
atctacttttgtggcaactcacttggtttacaacccaaaactacgcaaaattatattcaa
aaagagttgagtaattgggctgagatggctgttgatgggcatttccacggagaagatgcg
tggtatcatattcgaaaaaaatctaaaccagcacttgccgaaattgtaggagcacatgag
cacgaggtggtcgcgatgaataatttgacttcaaacctacactttttgatggtttcattc
tatcggccaaatgcaaaacgatttaaaataatcacagaagcaggagcatttccttccgac
atgtacatgttggaaactcaagtaaaatttcatggactagaccccaataaagcaattgtc
gaattagctcctagggatggagagcatacactacgaacggaggatattcttcaatcgatc
aaagaacaaggtgaggaactggctttagtaatgatggcagggctgcaatattacacaggt
caagtttttgatatgaaagcaattgctcaagccgtaaaagatgaaggagcttttgttgga
tttgatttagctcatgcagctggcaatgttcctttggctttacacgattggggtgtggat
tttgctacatggtgtagttataaatacatgaactctggtccagggaatgtttcggggata
tttgttcatgaaaatcatgctgaaaaacctgacatgatacgtttcgcaggatggtggggt
catgatgaaggggagcgattcaaaatggaaaaaggcttcaagcctatgtttggtgctgac
ggttggcaacttgccaactctaatgtgttggcattggcagcgcatcaagcttctttagat
atatttcaacaggctggaattaaaactttaagagaaaaaagtgaaactttaacctcatat
cttgagtttttaattcaaaaaataagtggaaatagtggtgtacttgaaataattacaccc
aaaaacataaacgagcgcggctgtcaattatctttgctcgttcataaaggcgggaaggct
gttttcgatgagttttataaaaacggcattgttggagattggagaaatccaaatgtgatt
agaatagctcctacacccctttataacagctatgaagatgtgtttagatttgccaaaatc
ctagagcaatcactgcaaaagtttgcgtga

DBGET integrated database retrieval system