KEGG   Belliella baltica: Belba_1496Help
Entry
Belba_1496        CDS       T02134                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bbd  Belliella baltica
Brite
Enzymes [BR:bbd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Belba_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFL84110
UniProt: I3Z4E2
LinkDB All DBs
Position
1584279..1584884
Genome map
AA seq 201 aa AA seqDB search
MAFELPKLPYDFNALEPHIDAKTMEIHHGKHHNAYVTNLNNAIAGTDLEGKSLEELMKVA
GSNAAVRNNGGGHYNHSLFWTVLAPNGGGQPSGDLAAAIDAKFGSFDAFKEEFNKAAATR
FGSGWAWLCVDEKKELCVCSSPNQDNPLMDVAECPGTPILGLDVWEHAYYLNYQNRRPDY
VGAFWNLVNWDEVSKRFAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaacttccaaaattaccctacgactttaatgcgctagagccgcatattgat
gcaaaaactatggaaatccaccatggtaagcaccacaatgcttatgtgactaacttgaac
aatgccatcgcaggaactgaccttgaaggcaagtctctggaagagttaatgaaagtagct
ggctcaaatgcagcagtaagaaacaatggtggtggtcactataatcacagccttttttgg
actgtcttagctcctaatggtggaggtcaaccttctggggatttggcagctgctatagat
gctaagtttggttcttttgatgctttcaaagaagaattcaacaaggcagcagcgactaga
ttcggttctggctgggcttggctttgtgtagatgagaaaaaagaactttgtgtgtgctct
tctccaaaccaagataatcctttgatggatgtagcggaatgcccgggtacgccaatccta
ggtcttgatgtttgggagcatgcttattatttgaactatcaaaacagaagacctgactac
gtaggagctttctggaacttggtcaattgggacgaagtaagcaaaagatttgcagcagct
aaataa

DBGET integrated database retrieval system