KEGG   Belliella baltica: Belba_1682Help
Entry
Belba_1682        CDS       T02134                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbd  Belliella baltica
Pathway
bbd00564  Glycerophospholipid metabolism
bbd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Belba_1682
Enzymes [BR:bbd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Belba_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Lycopene_cycl Pyr_redox_2 GIDA HI0933_like Pyr_redox_3 Pyr_redox Thi4 NAD_binding_8 3HCDH_N GMC_oxred_N NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AFL84288
UniProt: I3Z4X0
LinkDB All DBs
Position
complement(1792277..1793839)
Genome map
AA seq 520 aa AA seqDB search
MDRIENLKKLEVKDKVWDIAVIGGGASGLGVALDALSRGLSVVLVEKSDFAKGTSSRSTK
LVHGGVRYLAQGDVMLVFEALKERGRLLQNAPHLTHNQPFIIPIYTFFDRLQYSIGLKLY
DWMAGKLRLGKSRFISKKETIKRLPQIKQKGLQGGVVYHDGQFDDARLALSIAMTCDEMG
GIMLNYTKVNALIKNEKGTITGVQVRDLIGKKNHKIKAKMVVNATGVFADKILQLDQPGA
PKSIQPSQGIHLVLDRSFLGGNDALMIPKTSDGRVLFAVPWQDKLVLGTTDTLREKAKLE
PEALAKEISFVLETATAYLTKAPTRADVLSVYAGLRPLAAPKEGSTKTKEISRSHKVIVS
ESKLITITGGKWTTFRKMGEDTVNYYKQVTGEHLPESASANIKYKGYTTNPQDGHWKGYG
DDAEKIQSLINESPESGELLHPKYPYTTAEVIWSVRNEMAMKVEDILARRLRVLFLDAKA
AKAMASKVANIMAEEKGYNAAWVKEELTDFEKTVNKYILK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggataggatagaaaacttaaaaaaactcgaagtaaaagataaggtgtgggatattgca
gtgattggaggaggtgcttcgggtttgggagtagcactagatgcgctttcaagaggactt
tctgttgttttggtagaaaaatctgactttgcaaaagggacttctagcagaagcaccaaa
cttgttcatggtggagtaagatatctggctcaaggagatgtgatgttggtattcgaagcg
cttaaagaaagagggagattacttcaaaacgcacctcacctcacccataaccaacctttt
attattcccatttatacattttttgacaggttacaatatagtattggattgaagctgtat
gattggatggcggggaaacttcggctaggaaaatcccgctttatctcaaaaaaagaaacc
atcaaaagactacctcaaatcaagcaaaagggacttcaaggaggcgtagtctatcacgac
gggcaatttgatgatgcccgactcgctttaagcattgccatgacttgtgatgaaatgggt
ggaattatgctcaattataccaaggtgaatgcactaatcaaaaatgaaaaaggcacaata
actggagttcaggttagagatttgattggcaagaaaaatcataaaatcaaagccaagatg
gtcgtcaatgcaaccggagtttttgcggataaaatcctacaacttgatcaaccaggtgct
ccaaaaagcattcagcccagtcaaggaatccatttagttttggaccgttcatttcttggt
ggtaatgatgcgctgatgattcccaaaacatccgatggacgtgtactatttgctgtacca
tggcaggataaattggtcctaggaactacagatactttgagagaaaaagccaaacttgaa
cctgaagctttggcaaaggaaataagttttgttttagaaactgctactgcttatttgaca
aaagctccaactagagctgacgtgctttcagtttatgcaggccttagacctttggcagca
ccgaaagaaggtagcaccaaaacaaaagaaatctcacgctctcacaaagtcatcgtgtca
gaaagtaaattaattacaataacaggtgggaagtggacgacgtttagaaaaatgggcgaa
gacactgtgaattattacaaacaagtcacgggtgagcatcttcctgaaagtgcttctgcc
aatatcaaatataaaggatacactactaatccacaagatggacattggaagggttatggt
gatgatgctgagaaaatccagtctttgataaatgaaagtccagaatcaggagaattgctt
catccaaaatacccctacacaactgccgaagttatttggtcagtaagaaatgaaatggct
atgaaagtagaagacattcttgcgagaagattgcgtgtgttattccttgatgccaaagct
gccaaagccatggcttcaaaagtggctaatatcatggccgaggaaaaaggctacaatgct
gcttgggtcaaagaagaactcactgatttcgagaaaacagtaaataagtatatattgaaa
tga

DBGET integrated database retrieval system