KEGG   Belliella baltica: Belba_1694Help
Entry
Belba_1694        CDS       T02134                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bbd  Belliella baltica
Brite
Translation factors [BR:bbd03012]
 Eukaryotic Type
  Elongation factors
   Belba_1694
 Prokaryotic Type
   Belba_1694
Mitochondrial biogenesis [BR:bbd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Belba_1694
Exosome [BR:bbd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Belba_1694
  Exosomal proteins of breast cancer cells
   Belba_1694
  Exosomal proteins of colorectal cancer cells
   Belba_1694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AFL84297
UniProt: I3Z4X9
LinkDB All DBs
Position
1802977..1804164
Genome map
AA seq 395 aa AA seqDB search
MAKATFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARKGLSELRDFSSIDNAPEEKERG
ITINTSHVEYQTEKRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLARQVGVPALVVFLNKVDLVDDPELLELVEMEVRELLSFYDFDGDNIPVISGSALGGLE
GNEKWMDKIMELMDAVDEFIPIPERLVDKDFLMPVEDVFSITGRGTVATGRIERGVINSG
DPVDIIGMGAEGLKSTVTGVEMFRKILDRGEAGDNVGLLLRGIEKSQIKRGMIICKPGSV
KPHAHFKAEVYVLSKEEGGRHTPFFNKYRPQFYLRTTDVTGEIKLPEGVEMVMPGDNVTI
EVNLLNKVALEKGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcaacctttgaccgttccaaaccgcacgttaatatcggtacgattggtcac
gtagaccatggaaagacaactttgactgctgccattactacagtattggccagaaaaggt
ctttctgaactaagagatttctcttctatcgacaacgctccagaagaaaaagaaagaggt
atcactatcaatacttcacacgttgagtatcaaactgaaaagagacactacgctcacgta
gattgtccaggtcacgctgattatgtgaagaacatggtaactggtgctgctcagatggat
ggcgctattctagtagtagccgcaactgacggaccaatgcctcaaactagagagcatatc
cttcttgctcgtcaggtaggtgtaccagcacttgttgtattcttgaacaaagtggatttg
gtagatgaccctgaacttcttgaacttgtagaaatggaagtaagagaactgttatctttt
tatgattttgatggtgataacatcccagttatttctggatctgctctaggtggattagaa
ggtaacgaaaaatggatggataaaatcatggaattaatggacgcagttgatgagttcatt
ccaattccagagcgtcttgttgacaaagatttcttgatgcctgttgaagatgttttctcg
atcactggtcgtggaactgtagcaactggtagaattgaaagaggtgtaatcaactcaggc
gatccagtagacattatcggtatgggtgctgaaggcttaaagtctacagttactggtgtt
gaaatgttccgtaaaatccttgatagaggtgaagcaggtgataacgtaggtcttttgttg
agaggtattgaaaagtctcaaatcaagagaggtatgattatctgtaagccaggttctgtg
aagccacacgctcacttcaaggctgaagtttacgttctttcgaaagaagaaggtggacgt
catactccattcttcaacaaatatcgtccacagttctacttaagaacaactgacgtaact
ggtgagatcaaacttccagagggtgttgaaatggttatgccaggtgataacgttacaatc
gaagtaaacttattgaataaagttgcccttgagaaaggcttacgttttgctatccgtgag
ggtggtagaacagtaggtgctggtcaggtaactgaaattcttgactaa

DBGET integrated database retrieval system