KEGG   Belliella baltica: Belba_2346Help
Entry
Belba_2346        CDS       T02134                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bbd  Belliella baltica
Pathway
bbd00500  Starch and sucrose metabolism
bbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Belba_2346
Enzymes [BR:bbd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Belba_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AFL84906
UniProt: I3Z6N8
LinkDB All DBs
Position
complement(2502991..2505102)
Genome map
AA seq 703 aa AA seqDB search
MKKLVNIILLFSLSFLAMGQQISSPNGELQLDFELKEGVPYYSLNYKNKPIILPSKLGLE
LKGKSDFTSGFVISNADKREFDETWEPVWGEEKSIRNHYNEMTLTLHQDAEHDHRTLVIR
FRLFDDGLGFRYEFPSQPNLAHFIISDEKTQFAMAGDHTAFWIPGDYDTQEYDYVESKLS
EIRTLMTQAITANVSQTSFSPTGVQTSLMMKTKDGLYINLHEAALIDYATMHLNLDDEKM
IFESWLTPNANGDKVYLQSPSVSPWRTIIVSDDARDILASRITYNLNEPNKIEDTSWIKP
MKYVGVWWEMITGKSSWAYTDEFPAVKLGVTDYSKAKPNGKHGATTANVKRYIDFAAEHG
FDGVLVEGWNIGWEDWFGNAKDYVFDFVTPYPDFDLEGVRDYAKVKGVEMIMHHETSSSV
RNYERQIDKAYQFMKDNGYNAVKSGYVGTILPFGDNHYSQWQVNHYQYAIEKAAEYQIMV
NAHEAVRPTGIGRTFPNLIANESARGTEYQAFGGSKPNHVTVLPFTRQIGGPMDYTPGIF
EMDVSKLNPDNNSWVNSTIANQLALYVTMYSPLQMAADLPENYERFMDAFQFIKDVGLDW
EKSVYLEAEPGYYLTIARKEKGTGNWFLGNVNGNEGRTVEIKFDFLEAGKKYEAIIYSDT
KDAHYRNNPQAYEIKKIKLTSKSKLSQYSAPGGGFAISIMEVQ
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttagtaaacattattcttctcttcagcctgagttttttggctatgggacaa
caaatcagttctccaaatggagagctacaattggattttgaattgaaagaaggagttcct
tattattctttaaattacaagaacaaacctataattcttccaagtaaactagggcttgaa
ctaaaaggaaagtctgactttacaagtggattcgtcatctctaatgctgacaaaagagaa
tttgatgaaacttgggagcctgtgtggggcgaagaaaaaagtatcagaaatcattataac
gaaatgactttgaccctgcatcaagatgctgagcatgaccatagaactttggtcataaga
tttaggctttttgatgatggactaggattcagatacgaatttccttcacagcctaatttg
gcacatttcattatttcagatgaaaaaacacaattcgctatggcgggagaccatactgct
ttttggattcctggcgactatgatacacaggaatatgactacgtagagtcaaagctatcc
gaaattagaactttgatgacgcaagccatcactgccaatgtttcacagacttccttctct
cctactggagttcagacttcattgatgatgaaaacaaaagatggtttgtatatcaatttg
catgaagctgccttaattgattatgcgacgatgcacttgaatttggatgatgaaaagatg
atttttgaatcctggttaactcccaatgcaaatggagacaaagtgtacttacaaagtccg
tctgtcagtccttggaggacaataatcgtttcagatgatgcaagagatatattagcatca
agaatcacctacaacctcaacgagcctaataaaattgaagatacttcttggatcaagccg
atgaaatatgttggtgtttggtgggaaatgatcacaggaaaaagcagttgggcttataca
gatgaattccctgctgtaaaattaggagttacggactacagtaaagccaagccaaatggg
aaacatggtgcaactactgccaatgtcaaaagatatatagattttgctgctgaacatggt
tttgatggggttttggtagaaggttggaatatcgggtgggaagattggtttggcaatgcc
aaagattatgtctttgatttcgtcactccgtatcctgattttgatctagaaggtgtgaga
gattatgcgaaagtaaaaggtgtagaaatgatcatgcatcacgaaacttcctcctctgtc
cgaaactatgaaagacaaatagacaaggcttaccaattcatgaaagacaatggctacaat
gccgtcaaaagtggctatgtgggtaccattctcccttttggagacaatcattacagtcag
tggcaagttaatcactatcaatatgcaatagaaaaagcagctgaatatcaaatcatggtg
aatgcccacgaggctgttagaccaacaggtatcggaagaacatttcctaatctgattgcg
aatgaatctgctagaggaacagaatatcaggcttttggagggtcgaaaccaaatcatgtg
accgtattgccatttacaagacagattggaggaccgatggattatacgccagggattttc
gaaatggatgtcagtaagcttaatcctgataataattcttgggtgaacagcacgattgcc
aatcaacttgcactatatgtgacaatgtatagcccattacaaatggccgcagatttacca
gaaaactatgaaaggtttatggatgccttccaattcatcaaagatgtaggtttggactgg
gaaaaaagcgtttatttggaagctgagccaggttattatctcaccattgcaagaaaagaa
aaaggaactggaaattggtttttgggaaatgtcaatggaaatgaaggaagaactgtagag
atcaaatttgattttcttgaagctgggaagaaatatgaagccattatttattcagacact
aaagatgcgcattacagaaataatcctcaggcttatgaaatcaaaaagataaaattgacc
agtaagtctaagctttctcaatacagtgctccaggaggaggatttgcgatcagtattatg
gaagtgcagtaa

DBGET integrated database retrieval system