KEGG   Belliella baltica: Belba_3819Help
Entry
Belba_3819        CDS       T02134                                 

Definition
(GenBank) ribonucleotide reductase, beta subunit
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
bbd  Belliella baltica
Pathway
bbd00230  Purine metabolism
bbd00240  Pyrimidine metabolism
bbd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Belba_3819
   00240 Pyrimidine metabolism
    Belba_3819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbd03400]
    Belba_3819
Enzymes [BR:bbd01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     Belba_3819
DNA repair and recombination proteins [BR:bbd03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Belba_3819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm DUF4744
Motif
Other DBs
NCBI-ProteinID: AFL86301
UniProt: I3ZAN3
LinkDB All DBs
Position
complement(4128807..4129787)
Genome map
AA seq 326 aa AA seqDB search
MQQYEPILQENKNRFVLFPIQHNDIWQYYKKAEASFWTAEEIDLSQDLSDWKNLNDGERH
FISHVLAFFAASDGIVNENLAEHFVSEVQYTEAKFFYGFQIAMENIHSETYSLLIDTYIK
DNQERDKLLNAIEHIDCVKKKAEWALRWIDNGSFQERLIAFAAVEGIFFSGSFCSIFWLK
KRGLMPGLTFSNELISRDEGLHCDFACHLYTEHVKNQLPKETVAMIIKDAVEIEKEFVTD
ALPVRLIGMNSDLMCQYIEFVADRLLMELGCEKVWNSTNPFDFMDMISLQGKTNFFEKRV
GDYQKAGVMKSNEINESPKFSIGEDF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagtacgaaccaattcttcaggaaaacaaaaatcgttttgttttattcccaatt
cagcacaatgatatctggcagtattataagaaagcagaagcaagtttttggactgcagaa
gaaattgatttgagccaagatttgagtgattggaaaaatctaaacgatggggagagacat
tttatctctcacgtattggcattctttgctgcgagtgatggtattgtcaatgagaactta
gcagagcatttcgtgtctgaagtacagtatacagaagcaaaattcttttatggttttcag
attgctatggaaaatattcattctgaaacttatagcttactaattgatacttacattaag
gataatcaagaaagagataaattgctcaatgctatcgagcatattgattgtgtaaagaaa
aaggcagagtgggctttaagatggattgataatggatcatttcaggaaagattgatcgca
tttgcggccgtggagggaatattcttttcaggttcattctgttctatattttggttaaag
aagagaggattgatgccaggactgacattctcaaatgagttgatttctagagatgaagga
ttacattgtgattttgcgtgccacctttataccgagcatgttaaaaatcagcttccaaaa
gaaacagttgcaatgattatcaaagatgctgtggagatagaaaaggaatttgttacagat
gctttgccagtaagattgatcgggatgaattctgatttgatgtgtcagtatatagagttt
gtagcagataggttgttgatggaattaggttgtgaaaaagtttggaacagtaccaatcca
tttgatttcatggacatgatctctcttcagggaaaaacaaacttctttgaaaagagagtt
ggtgattatcagaaagctggtgtaatgaaatcaaacgaaattaatgaatcaccaaaattc
tccatcggtgaggatttttaa

DBGET integrated database retrieval system