KEGG   Brevibacillus brevis: BBR47_04980Help
Entry
BBR47_04980       CDS       T00879                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00473  D-Alanine metabolism
bbe01100  Metabolic pathways
bbe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBR47_04980 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BBR47_04980 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbe01011]
    BBR47_04980 (alr)
Enzymes [BR:bbe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BBR47_04980 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bbe01011]
 Precursor biosynthesis
  Racemase
   BBR47_04980 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAH41475
NITE: BBR47_04980
UniProt: C0ZK24
LinkDB All DBs
Position
508780..509982
Genome map
AA seq 400 aa AA seqDB search
MKSFCRDTWVEVDLDAIRANLETFKRHLPEKTDIMAVVKADGYGHGAVHVGKEALASGAD
SLAVALLDEALILRRAGITAPILVLGYTPVESIVTASELEVELTAYSVEWITEANDILQK
NDHKPVGIHVKTDTGMGRLGVRTKEDLLAVVGALEECSKLKWTGIFTHFACADEPDTTHV
RRQHDLFQSFLQALREANKKLPTVHCCNTAAAIAFPDWGYDTIRLGIGLYGLYPSLYMKE
RADVILTPALALKTRIAHVKKADEPFTVSYGATHTAQPDEWIATLPIGYADGYSRLLSNR
GEVLYNGTRYPIAGRVCMDQIMVSLNSTEAAVNDEVVLYGKQGDEEISLDEIADLLGTIN
YEVPCMLNYRIPRLYLRDQKVTDVFHPLTMKHSSHENVNI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttttgtcgtgacacttgggtagaggttgatttggatgccatccgggcgaac
ctcgagacattcaaacgccatttgccagaaaaaacggatattatggctgttgtgaaagca
gacgggtatggtcatggtgctgtccatgttggaaaagaagcgttggcgagcggtgcagat
tcacttgcagtcgcattgctcgatgaagcgcttattttgcggagggcagggatcacagca
ccgattttagtgttgggatacacacctgtcgagtccattgtcactgcaagcgagctggaa
gtggagttaactgcttacagcgtcgaatggatcacggaagcgaacgacattcttcagaaa
aacgatcacaagcctgtcggaattcatgtgaagaccgatacggggatgggacgtttgggc
gttcggacaaaggaagatttgcttgcggttgtaggtgcccttgaagaatgctcgaagctt
aagtggacaggcatttttacgcattttgcctgcgcggatgaaccagatacaacccatgtg
cgacgacaacacgacttgtttcaatcctttttgcaagcactgcgtgaagcaaataaaaaa
ttgccgaccgttcattgctgcaatacggctgcggctatcgcatttcccgattgggggtat
gatacgattcgtttaggcataggtttatacggattgtatccttctttgtacatgaaagaa
cgtgcggatgttattcttacccccgcgctggcgctcaagaccagaattgcccacgtgaag
aaggcagatgagccatttaccgtcagctatggtgctacgcatacagcacagccggatgag
tggattgcaacgctgccgattggatacgcagatggctattctcgccttttgtccaaccgc
ggtgaggtgttgtacaatggcacgcgctacccgattgcaggcagagtttgcatggaccaa
atcatggtcagcctgaattcgacagaagcagcggtcaatgatgaggtcgtcttgtatggt
aagcagggtgatgaggaaatctccttggatgaaattgccgatttgctgggaacaatcaat
tacgaggttccttgtatgctgaattaccgaattccgcgcctttatttgcgcgaccagaag
gtaacggacgtatttcacccattgacgatgaagcactcgtcccatgaaaatgtaaatatc
tag

DBGET integrated database retrieval system