KEGG   Brevibacillus brevis: BBR47_13830Help
Entry
BBR47_13830       CDS       T00879                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00030  Pentose phosphate pathway
bbe00051  Fructose and mannose metabolism
bbe00052  Galactose metabolism
bbe00680  Methane metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
bbe01230  Biosynthesis of amino acids
bbe03018  RNA degradation
Module
bbe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_13830 (pfk)
   00030 Pentose phosphate pathway
    BBR47_13830 (pfk)
   00051 Fructose and mannose metabolism
    BBR47_13830 (pfk)
   00052 Galactose metabolism
    BBR47_13830 (pfk)
  09102 Energy metabolism
   00680 Methane metabolism
    BBR47_13830 (pfk)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BBR47_13830 (pfk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bbe01009]
    BBR47_13830 (pfk)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bbe03019]
    BBR47_13830 (pfk)
Enzymes [BR:bbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BBR47_13830 (pfk)
Protein phosphatases and associated proteins [BR:bbe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BBR47_13830 (pfk)
Messenger RNA biogenesis [BR:bbe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BBR47_13830 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: BAH42360
NITE: BBR47_13830
UniProt: C0Z7W7
LinkDB All DBs
Position
1422784..1423743
Genome map
AA seq 319 aa AA seqDB search
MRKLAVLTSGGDSPGMNAAVRAAVRRAHFHEVQMFGVYHGYEGLMRGDIKEMSLGSVGDI
IQRGGTILYSARSEAFKTEAGQQRAVEQLRAHEIEGLIVIGGDGSFRGAQKLTEKGFPTI
GVPGTIDNDIPCTDFTIGFDTALNTVVEAIDKIRDTATSHERTYIIEVMGRDAGDLALWA
GLAAGAESIMIPEASQDMDDIIERLHAGQRRGKKHSIIIVAEGVGSAASYAEAITKETGW
ETRVTVLGHIQRGGSPTAMDRMLASRMGAAAVDLLLEGKQDRMVGVQNNQIVDVDFQEAL
AKKHQLDLSIYQLARTLSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaacttgcagttctcactagcggtggagattctcctggaatgaatgccgccgtc
cgtgcggctgtacgtcgtgctcattttcacgaggtacaaatgtttggggtttaccacgga
tacgaagggctgatgaggggagatatcaaggagatgtctctaggctctgttggggatatt
atccaacggggaggaaccattctctactccgctcgcagtgaggcgttcaagacggaagcc
ggacagcaaagagcggtggaacaattacgtgctcatgaaattgagggtctgattgtcatt
gggggagacgggtcgtttcgcggtgcacagaagctaaccgaaaaaggtttcccgactatt
ggcgtaccgggtacgattgataatgatattccatgcaccgatttcacgatcgggtttgat
acggcattgaataccgtagtggaagcgatcgataaaatccgcgatacggccacctcgcat
gaacgcacgtacattattgaagtaatggggcgagatgctggcgatctggcattgtgggca
gggcttgcagctggtgccgagtccattatgatcccagaagcgtcgcaggatatggacgat
attattgaacgtttgcatgctggacaacgccgtggtaaaaagcattccatcatcattgtg
gcggaaggggtaggaagtgccgcttcttacgccgaagcgatcacgaaagagacaggctgg
gagactcgcgtgacggtactgggtcatattcaacgtggtggttcccctactgcgatggac
cgaatgctggcgagccgaatgggtgccgcagctgtcgatttgttgctggaaggcaagcag
gaccgaatggttggggttcaaaacaaccagatcgttgatgttgattttcaggaagcattg
gcgaaaaagcatcaattggatttatccatttatcaattggcgcgcacgctatctatataa

DBGET integrated database retrieval system