KEGG   Brevibacillus brevis: BBR47_13900Help
Entry
BBR47_13900       CDS       T00879                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00020  Citrate cycle (TCA cycle)
bbe00480  Glutathione metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
bbe01210  2-Oxocarboxylic acid metabolism
bbe01230  Biosynthesis of amino acids
Module
bbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBR47_13900 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BBR47_13900 (icd)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BBR47_13900 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAH42367
NITE: BBR47_13900
UniProt: C0Z7X4
LinkDB All DBs
Position
1433099..1434382
Genome map
AA seq 427 aa AA seqDB search
MFKNLTQPTVGEKITVDNGKLVVPNNPVIPFIEGDGTGPDIWKASVRVLDAAVEKAYKGE
KKIAWFEVFAGEKSFNQYSEWLPEDTLTAVREYLIAIKGPLTTPVGGGIRSINVALRQEL
DLYACVRPVQYFDGVPSPVKHPELTDMVIFRENTEDIYAGVEWAEGTPEVKKVIDFLQNE
MGVKKIRFPETSGIGIKPVSKDGTERLVRAAINYAIENNRKSVTLVHKGNIMKFTEGAFK
TWGYAVAEAEFGDKVFTWAQYDRIKAEGGDADKAQKEAEAAGKIIVKDVIADAFLQQILT
RPAEYDVVATLNLNGDYVSDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLD
KVNPSSVILSGEMMLRHLGWNEAADLIINSMEKTISAKTVTYDFARLMEGAKELKCSEFA
DALIQNM
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaaaacctgacgcaaccaactgtaggcgaaaaaattactgtggataacggtaaa
ttggtagttccaaacaatccagtcattcctttcatcgagggtgacggtactggccctgac
atttggaaagcttctgttcgcgttctggatgcagctgtagaaaaagcttacaagggcgag
aaaaaaatcgcttggttcgaagtattcgcaggtgaaaaatccttcaaccaatacagcgag
tggctaccagaagatacgctgactgctgttcgtgaatacctgatcgcaatcaaaggtcct
ttgactacgccagtaggcggcggtatccgttctatcaacgtagcactgcgtcaagagctg
gatctgtatgcttgcgtacgtcctgttcaatacttcgatggtgttccatccccagtgaaa
catcctgaattgactgacatggtaatcttccgtgagaacactgaagacatctacgctggc
gtagagtgggctgaaggtactccagaagtgaaaaaagtaatcgacttcctgcaaaacgaa
atgggcgtgaagaaaatccgcttcccagaaacttctggtatcggtatcaagcctgtttcc
aaagatggtacagagcgtctggttcgtgcagcgatcaactatgcgatcgagaacaaccgc
aaatccgttaccctcgtacacaaaggtaacatcatgaagttcacggaaggtgctttcaaa
acttggggatatgcagtagctgaagcagaattcggcgacaaagtattcacttgggcacaa
tacgatcgtatcaaagctgaaggcggcgacgctgacaaagcacaaaaagaagcagaagca
gctggcaaaatcatcgtgaaagatgttatcgctgacgcgttcctgcaacaaatcctgact
cgtccagctgagtacgacgtagtagcaacactcaacttgaacggtgactatgtatctgat
gcattggctgcacaagtaggcggtatcggtatcgctccaggtgcaaacatcaactacctg
actggtcatgcgatcttcgaagcaactcatggtacagctccgaaatacgctggtctggac
aaagtaaacccatcctccgtgatcctgtccggagaaatgatgctgcgtcacctgggctgg
aacgaagcagctgatctgatcatcaactccatggaaaaaaccatctctgcgaaaacagta
acatacgatttcgctcgtctgatggaaggcgcaaaagaactgaaatgctccgagtttgct
gacgctctgattcaaaacatgtaa

DBGET integrated database retrieval system