KEGG   Brevibacillus brevis: BBR47_14940Help
Entry
BBR47_14940       CDS       T00879                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase/alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bbe  Brevibacillus brevis
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBR47_14940 (ahpF)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BBR47_14940 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored DAO Thi4 FAD_binding_3 HI0933_like AlaDh_PNT_C K_oxygenase NAD_binding_8 Glutaredoxin Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAH42471
NITE: BBR47_14940
UniProt: C0Z901
LinkDB All DBs
Position
complement(1542825..1544354)
Genome map
AA seq 509 aa AA seqDB search
MALDQEIKAQLEQYLELLEGDIVLKVSAGTDEASSEMLALIDELASMSLKISVEKAELTR
TPSFSVNRVGEDTGVVFAGTPLGHEFTSLVLALLQVSGRAPKVEQSVIDQIKDLRGEYKF
ESYISLSCHNCPDVVQALNLMSIFNPGITHTMIDGAVFKDEVESKNVMAVPSVFLNGEFF
ESGRMTVEEILAKLGSAPDASEFDNKDPYDVLVVGGGPAGASAAIYAARKGIRTGLVAER
LGGQVNDTLGIENFISVKYIEGPQLAANLEKQVKEYGIDVMKLQRAKRLEKKDLIEVELE
NGAVLKSKTVILSTGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFIGKDVAVVGGGNSGV
EAAIDLAGIVKHVTVLEFSPELKADAVLQDRLYSLPNVTVLKNVQTKEITGTDKVNGISY
IERETGETKHIELQGVFVQIGLVPNTDWLGETIERTRFGEIVVDSHGSTNIPGVFAAGDC
TNSAYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcccttgaccaagaaatcaaagcgcaactagaacaatatctcgagctcttggaaggc
gatattgtactcaaagtcagtgcaggcacggatgaggcatcctcagagatgcttgcactg
attgatgagctagccagcatgtctttgaagatcagtgtggagaaagcagaactcactcgc
acacctagctttagcgtaaaccgtgtcggcgaagatactggcgttgtttttgccggtact
ccgctgggtcacgaatttacttccttggtattggctctcttgcaggttagcggaagagct
ccaaaggtcgagcaaagtgtcattgatcaaatcaaagaccttcgtggtgaatataagttc
gaatcttacatcagcttgagttgccacaattgtccagatgttgtccaagctctgaacttg
atgagtatcttcaatcctggtattactcatacaatgattgacggtgccgtattcaaggac
gaggtagagagcaaaaacgtgatggctgtgccaagcgttttcctcaacggtgaatttttc
gaaagcggccgtatgaccgtggaagaaattcttgccaagctgggttctgctccggacgca
tccgagtttgacaataaagacccctatgatgtacttgttgttggcggtggcccagcaggt
gctagtgcggcgatttatgcagcacgtaaagggattcgtactggtctcgttgctgaacgc
cttggcggtcaagtcaatgacacattgggcattgagaacttcatcagtgtgaaatacatt
gaaggtcctcagctcgcagccaacttggaaaagcaagtaaaagagtatggcattgatgtc
atgaagctgcaacgtgccaagcgtttggagaagaaggatctgatcgaagtcgaactcgaa
aacggcgctgttctgaagagtaagacagtcatcttgtcgacaggtgctcgttggcggaat
ctgggtgtaccaggtgaagcagagttcaagaacaagggtgtagcttattgccctcactgc
gatggtcctttgttcataggcaaagatgtcgcagttgttggcggcggtaattcaggtgtg
gaagcagcgattgatctcgcaggtattgtgaagcatgtaaccgttctggaattctcgcca
gaactgaaagctgacgcagtattgcaagatcgtctttacagtctgccaaatgtcactgta
ctcaaaaacgttcaaaccaaagaaattacgggtacagataaagtaaacggcatttcttac
atcgagcgtgagacaggtgaaaccaagcacattgaattgcaaggtgtgtttgtacagatc
ggtctggtaccaaatacagattggttgggcgaaacgattgagcgcactcgctttggtgaa
atcgtagtagacagccatggttctacaaacatccctggtgtttttgctgcgggtgattgc
acgaacagtgcttataaacagatcatcatttcgatgggatctggagctactgcggctttg
ggagctttcgattatctcatccgcaactaa

DBGET integrated database retrieval system