KEGG   Brevibacillus brevis: BBR47_17350Help
Entry
BBR47_17350       CDS       T00879                                 

Definition
(GenBank) hypothetical protein
Organism
bbe  Brevibacillus brevis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3552
Motif
Other DBs
NCBI-ProteinID: BAH42712
NITE: BBR47_17350
UniProt: C0ZAA3
LinkDB All DBs
Position
complement(1795923..1801103)
Genome map
AA seq 1726 aa AA seqDB search
MYKRRISNANKSKERENEKLLLLKKQAHYYEEKTNQLMQEVWHLQKLIEETSQKNEAYRE
QLEHLNQNLHDLDSKGAEWKQRLNDSQDMLQEMKGKLDYYEHLLKQRENAITDHQETEAK
LKRSIESLQTEIREQRKGPRLEEIMSKHQAQEAHLREHIDLLQRQVQSYEQKEAHWQKAL
HEQDQQQLSQIEEILHERQQHLDMIAHLEQQQLTWKQALDHANEEFESAQIRQHEQLSKI
ESLNQQLEDARAREEQTLSNLQQLTAASGNWEQREQELQMREQELQVREQNLHAFEHSLQ
AHEQELHDLEQELRGQGQELQSLSSSLETKEQDLHSQSQHIQKREQKLLGLEQELQTEWL
ELHTQADHLQTKEQELLVTEQKLEAKELELHSQTQELQARQQELLDFEQELHGQNQELQS
LQYNLQTKGQELLVTEQKLEAKELELHSQTQELQARQQELLSLEQELHGQNQELQSLKHN
LQTKEQELLVTEQKLEAKEQNLHSQIQELQARQQELLGFEQELHGQNQELQSLKHNLQTK
EQELLVTEQTLEAKEQDLHSQTQELQARQQELHVLKQELQTQDQELQSLKHNLQTKEQEL
LVTEQKLEAKELELHSQTQELQARQQELLGFEQALQAQGLEMHAQAQDLNSREQELHVLK
QELQTQDQELQSLQHNLETKEQQLQSQELVLHSQTQDLNSREQELLDIEQVLQTKGQELQ
SLKHNLQTQEQQLQSKEFELHSQTQDLNSREQELLELEQELQTQSQELQSLAQNLQTKEQ
QLQSKELELHSQTQDLNSREQELLDIEQELQIQGQELQSLAQNLQTKEQQLQSKELELHS
QTQDLNSREQELLELEQELQTQNQDLQSLVQNLQTKEQQLQSKELELHSQTQDLNSREQE
LLEFEQVLQTQDQELQSLKHNLETKEQQLQSKELELHSQTQDLNSREQELQTQGQELQSL
KHNLETKEQQLQSEELELQSQAQDLHGREQELLGIEQELQTQSQELQSLAQNLQTKEQQL
QSKELELHSQTQGLNSREQELLELEQELQTQNQDLQSLVQNLQTKEQQLQSKELELHSQA
QDLHGREQEVLELKQQLQSKELVLHSQTQDLHAQEQKLLELEQELQTHNQELQSLKHNLQ
TQEQQLQSKELELHSQTQDLNSREQDLLNFEQELQVQGQQLETQADHLQTKEQELLELEQ
GLKVQGQELLTQTQYLQAREQDLYTLEQELQTRGQELHSQNHNLQTKEQELLAFKQELQA
RDQEILERTRDLEAREEELNDVEQELQAQGKKLHAHAQALQVQEQELKSHEQGLRDWEQA
NLSQEQALLTQSQELQVQEQGLQSREQALQLRGEELLSHEQEIHSHEQELLTMKQELNFR
DQELHNQEQELHAQANTLHTREQELLTREQELNTLEQALLSLEQEIQAQRQGLQTREQEL
QVQNQDIYTREQELEAQKQDLRTKEQELEATRHEMLQKAIDLEQSWTIKHEETSQQLTEA
LLELETARLTKNQLVADYKKLAELHSLHEQELQQSIQQRDEEIQQTQNTVKSLQSELKEA
QQQLTDAQDRIKAFQQQAKETDEKLANVSLQKNKWNEVLEKTTQKYDSLLTEKEKTIEQL
TSQEQVLKKTITGLKNMVKEHQNNEEKYKQIIKEFTQKEARSNKAFSQLQQNVQFQPNTQ
FQPSAQFHSNTQFMPSSDPSTQQLSSTPVKMQMPYPKNANEFNPFR
NT seq 5181 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaaaaggagaatctccaatgcgaacaagtcgaaagagagagaaaatgagaagctc
ctcctgctaaaaaaacaagcacactactacgaagaaaaaacaaaccaactcatgcaagaa
gtgtggcacctacaaaagctgatcgaggaaacatcccaaaaaaacgaagcatatagagag
cagcttgaacatctgaaccagaacctccacgatttggacagcaaaggggccgaatggaag
cagcgcttgaacgattcacaagacatgcttcaagaaatgaagggcaagctcgactactac
gaacatctcttgaaacaacgcgaaaatgccataaccgaccaccaggaaacagaggcaaaa
ctaaagcgttcaatcgagagcttgcaaaccgagatcagagaacaacgaaaaggtccacga
ctggaagaaatcatgtccaaacatcaagcccaggaagcacacttgcgcgagcacattgat
ttgctccagcggcaagtacaaagctacgaacaaaaagaggcacactggcaaaaggcgtta
cacgagcaagatcagcagcagctgagtcaaatcgaggagatcctgcatgaacgccagcag
catttagacatgatcgcgcatctggagcagcaacaacttacatggaaacaagctttggat
catgcaaatgaagagtttgagagtgcgcagataagacagcacgagcaactatccaaaatt
gaatcattgaatcagcagttggaggatgcacgggcacgggaagagcaaacactctctaac
ctacagcagcttacagcagcaagcggaaattgggagcaacgggagcaggagctacagatg
cgagaacaagaactacaggtgcgcgagcaaaacctccacgcctttgagcatagtctccag
gctcacgagcaggagctgcacgatcttgaacaagagctgcgggggcaagggcaggaactg
caatccctatcgagtagccttgagacgaaagagcaggatctacactctcagtcgcaacac
atacaaaaacgggagcagaaactgctcggtcttgaacaagagcttcagaccgaatggtta
gaactgcatacgcaagcggatcacctgcagaccaaagaacaggagttgcttgttactgag
caaaagctcgaggctaaggagctagagctacattctcagacacaagagcttcaagcacga
cagcaggaacttctcgattttgagcaagagttgcacgggcaaaaccaagaactgcaatcc
ttacaatataacctgcagaccaaaggacaagagctgcttgttactgagcaaaagctcgag
gctaaggagctggagctgcattctcagacacaagagcttcaagcacggcagcaggaactt
ctcagtcttgaacaagagttgcacgggcaaaaccaagaactgcaatccttaaaacataac
ctgcagaccaaagaacaagagctgcttgttactgagcaaaagctcgaggctaaggagcaa
aatctgcattctcagatacaagagcttcaagcacggcagcaggaacttctcggttttgaa
caagagttgcacgggcaaaaccaagaactgcaatctttaaaacataacctgcagaccaaa
gagcaagagctgcttgttactgagcaaacgctcgaggctaaggagcaggatctgcattct
cagacacaagagcttcaagcacggcagcaggaacttcacgttctcaaacaagagcttcag
acacaagaccaagaactgcaatccttaaaacataacctgcagaccaaagagcaagagctg
cttgttactgagcaaaagctcgaggctaaggagctagagctacattctcagacacaagag
cttcaagcacgacagcaggaacttctcggttttgaacaagcgttacaagcgcaaggacta
gaaatgcacgctcaggcacaagacctcaactcacgggagcaggaacttcacgttctcaaa
caagagcttcagacacaagaccaagaactgcaatccttacagcataaccttgagacgaaa
gaacaacagctccagtcccaagagctagtgctgcattcccaaacacaagaccttaactca
cgagagcaggaacttcttgatatcgaacaagtgcttcagacaaaaggccaagaacttcaa
tccctaaagcataacctgcagacgcaagagcaacagcttcagtccaaagagtttgagctg
cattcccaaacgcaagacctcaactcacgtgaacaagaacttctcgagctcgaacaagag
cttcaaacacaaagccaagagcttcaatccctagctcaaaacctgcaaacgaaagaacaa
cagctccagtccaaagaacttgagctgcattcccaaacacaagacctcaactcacgggag
caggaacttcttgatatcgaacaagagcttcagatacaaggccaagaacttcaatcccta
gctcaaaacctgcaaacaaaggaacaacagcttcagtccaaagagcttgagctgcattcc
caaacacaagacctcaactcacgggagcaggaacttcttgagctcgaacaagaacttcag
acgcaaaaccaagacctccaatccttggttcaaaacctgcaaacgaaagaacaacagctc
cagtccaaagagcttgagctgcattcccagacgcaagacctcaactcacgagagcaggaa
cttctcgagttcgaacaagtgcttcagacacaagaccaagaacttcaatccttaaagcat
aaccttgagacaaaagaacaacagctccagtccaaagagcttgagctgcattctcaaacg
caagacctcaactcacgtgaacaagagcttcagacacaaggccaagaacttcaatcccta
aaacataaccttgagacgaaagaacaacagcttcagtccgaagagcttgagttgcaatcc
caagcgcaagacctccacggacgggagcaggaacttctcggtatcgaacaagagcttcaa
acacaaagccaagagcttcaatccctagctcaaaacctgcaaacgaaagaacaacagctc
cagtccaaagaacttgagctgcattcgcaaacgcaaggcctcaactcacgggagcaagaa
cttctcgagctcgaacaagagcttcagacgcaaaaccaagacctccaatccttggttcaa
aacctgcaaacgaaagaacaacagcttcagtccaaagagcttgagctgcattcccaagcg
caagacctccacggacgggagcaggaagttctcgagctcaaacaacagctccagtccaaa
gagctagtgctgcattcccaaacgcaagacctccatgcacaagaacaaaaacttctcgag
ctcgagcaagaacttcagacgcacaaccaagaacttcaatccctaaaacataacctgcag
acgcaagaacaacagctccaatccaaagagctagagctgcattcccagacgcaagacctc
aactcacgggaacaggatcttctcaatttcgagcaagagctccaagtacaagggcaacag
ctggaaacgcaagcagatcacctccaaacaaaagaacaagaacttctcgagctcgaacaa
ggacttaaagttcaagggcaagagcttctcacccagacgcaataccttcaagctcgagag
caagacctatatacccttgagcaagagctacaaacgcgcgggcaagaacttcactctcag
aatcataacctccagacaaaagaacaagagctgctcgctttcaaacaagagcttcaggcc
cgagatcaagaaattctcgagcggacgcgagaccttgaagcacgtgaagaagaactaaac
gatgttgaacaagagctccaggcccaaggaaaaaaactacatgctcatgcacaggccttg
caggttcaagaacaagagctcaagagccatgaacaagggcttcgggattgggaacaagcc
aacctctctcaggagcaagcacttttaacgcagagccaagaactacaggttcaagaacaa
ggacttcaatcccgagagcaagcactgcagcttcgcggggaggagcttctctctcatgag
caggaaatccactcccacgagcaagagctactcacgatgaaacaagagctgaacttccga
gatcaagaactgcacaaccaagagcaggagctgcacgctcaagcgaataccctacacact
cgtgaacaggagttgcttactcgggagcaagaactaaacacactggaacaggcactactc
tctttggagcaagaaatccaagctcaaaggcaagggctgcaaacccgggagcaggagcta
caagtacagaatcaagacatctacacccgagaacaagaactcgaagcacaaaaacaagat
ttgcgcacgaaagagcaagagctagaagccactcgccatgagatgttgcaaaaagcaata
gatctcgagcaaagttggacaataaagcacgaagagacttctcagcaattaacggaagcc
ctgcttgagctggaaacagcccggttaacgaaaaatcaactcgtagccgattataaaaag
ctggccgaattgcattccctgcatgagcaagaattgcagcaaagcatccaacaacgcgac
gaagaaatccaacaaacacaaaacactgttaagagtctccagtcggagttaaaagaagct
caacagcaattaaccgatgcacaggatcgtatcaaagcttttcagcaacaagccaaggaa
accgatgaaaagctcgcgaacgtctctcttcaaaaaaataaatggaacgaagtactggag
aaaacaacccaaaaatatgactctctgttaacagaaaaggaaaaaaccattgagcagctt
acatcccaggagcaagtgttgaaaaagacgataaccggacttaaaaacatggtgaaagaa
caccaaaacaacgaagaaaaatacaagcaaatcatcaaggaattcacgcaaaaagaagct
cgatccaataaagccttcagtcaactccagcaaaatgtccaatttcagccaaacacgcaa
tttcaaccaagcgcccaattccactcaaacacccaattcatgccaagctctgatccctcc
actcaacagttatcttccacaccagtaaaaatgcagatgccctatcccaaaaatgccaac
gaattcaacccgtttcgttga

DBGET integrated database retrieval system