KEGG   Brevibacillus brevis: BBR47_18810Help
Entry
BBR47_18810       CDS       T00879                                 

Gene name
apt
Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00230  Purine metabolism
bbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BBR47_18810 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbe04147]
    BBR47_18810 (apt)
Enzymes [BR:bbe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     BBR47_18810 (apt)
Exosome [BR:bbe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBR47_18810 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase
Motif
Other DBs
NCBI-ProteinID: BAH42858
NITE: BBR47_18810
UniProt: C0ZAP9
LinkDB All DBs
Position
1974223..1974735
Genome map
AA seq 170 aa AA seqDB search
MDFKQYIRVIPDFPQPGIRFKDITTLLKDGPAYKAAIQDLAVFAREVQADVIAGPEARGF
VVGAPLSYEMGIGFVPIRKSGKLPYESIKANYDLEYGKDALAVHVDAIQPGQRVLIADDL
LATGGTIETTINLIEQLGGKVVGAAFFIELSYLDGRSKIGEIPIKSLVQY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggattttaaacaatacattcgtgttatcccagattttccacagccaggtattcgtttc
aaggacatcactactctcttgaaggatggccctgcttacaaagctgcgatccaagacttg
gctgtcttcgctcgtgaagtacaagcagacgtaattgcgggtccagaagctcgtggattc
gtagtaggtgcgccattgtcgtacgaaatgggaattggctttgtaccgatccgcaagtct
ggcaagctgccatatgaatccatcaaggcgaattacgacctggagtatggaaaagatgcg
ctggctgtacacgtggatgctatccaaccaggtcagcgtgttctgattgcagacgatttg
ctggcgacaggtggaaccattgagacaacaatcaatttgattgagcaactcggtggcaaa
gtagtaggagctgccttcttcatcgaactgtcctacttggatggacgtagcaaaataggt
gaaattcctatcaaatcgctcgttcaatattaa

DBGET integrated database retrieval system