KEGG   Brevibacillus brevis: BBR47_36460Help
Entry
BBR47_36460       CDS       T00879                                 

Gene name
ligB
Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BBR47_36460 (ligB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbe03400]
    BBR47_36460 (ligB)
Enzymes [BR:bbe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BBR47_36460 (ligB)
DNA repair and recombination proteins [BR:bbe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BBR47_36460 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: BAH44623
NITE: BBR47_36460
UniProt: C0ZFR4
LinkDB All DBs
Position
complement(3825278..3826213)
Genome map
AA seq 311 aa AA seqDB search
MNPIIPMEPISCEVIPQGDDWIAQVKWDGVRILTYFDGQRTHLYNRRINERTHQYPELAD
IQTYCKARSVILDGEVIALGADGKPSFHEVMRRDGIRRLEKVSQAQKAVPITYMIFDVLF
TNNEWVIDLTLRERLNLLSEIIIPNDHVQLVEGHDDGNAMYEVIKQHGMEGIVMKNLNSK
YVIGGKEKQWQKKKYYRDTIAVVGGVTLRDNVVNSLLLGLYDPQGRLFYIGHAGTGKLTR
NDWVTLTEKIVPLIQNDRPFANTPARFKGAVWLRPSVTVKVQFAEWTEGYTLRQPSIQAV
VDIPVDYCVLE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaattatacctatggagccaattagctgtgaggtaataccccagggggacgac
tggatcgcccaagttaaatgggatggagttcgaatcctaacttactttgatggtcaaagg
actcatttatacaatcggagaataaatgagcggactcaccaatacccagagttagctgac
atacagacatattgtaaggctcgctcggtgatcttagatggagaagtgattgcactagga
gctgacggaaaaccgtcctttcatgaagtgatgcgtcgggatgggattagacgattggag
aaagtcagccaggcacagaaggctgtccccattacctacatgatatttgatgtcctattt
acaaataatgagtgggtaatcgatcttacattgagagagcgtctcaacttattatcagaa
atcattattcccaacgaccatgtacaattagttgaaggtcatgatgatggaaacgctatg
tatgaggtcatcaaacagcatggtatggaaggcattgttatgaagaatctaaacagtaaa
tacgtcattggtgggaaagagaaacagtggcaaaagaaaaaatactatcgtgacaccata
gctgtagtcgggggagttacgctgcgtgataacgttgtgaattctctcttgttagggctg
tatgatccccaagggcgcttattttatataggccacgcaggaacaggtaaattaactcga
aatgactgggtgactctgacggaaaagattgtacctttgatacaaaatgataggcccttt
gcaaataccccagcaaggttcaagggtgctgtgtggctgagaccaagtgtcacggttaag
gtacaatttgcggagtggacagaaggctatacgttacggcaaccgagtattcaagcagtt
gttgatatacctgttgattactgtgtcttggagtag

DBGET integrated database retrieval system