KEGG   Brevibacillus brevis: BBR47_41960Help
Entry
BBR47_41960       CDS       T00879                                 

Gene name
acoN
Definition
(GenBank) aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00020  Citrate cycle (TCA cycle)
bbe00630  Glyoxylate and dicarboxylate metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
bbe01130  Biosynthesis of antibiotics
bbe01200  Carbon metabolism
bbe01210  2-Oxocarboxylic acid metabolism
bbe01230  Biosynthesis of amino acids
Module
bbe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
bbe_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBR47_41960 (acoN)
   00630 Glyoxylate and dicarboxylate metabolism
    BBR47_41960 (acoN)
Enzymes [BR:bbe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     BBR47_41960 (acoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: BAH45173
NITE: BBR47_41960
UniProt: C0ZHP9
LinkDB All DBs
Position
4427622..4430351
Genome map
AA seq 909 aa AA seqDB search
MANKDAYKVKSSLQVGDKSFAYYRLQGLEEQGLGDVSKLPFSIKVLLEAAVRQFDGRAIT
KEHVQQLATWTKGRDENQEVPLMPARIVLQDFTGVPAVVDLAAMRIAMKRAGGDPKRINP
LVPVDLVIDHSVMVDDFGNASALDNNMKLEFERNQERYRFLRWAQTAFDNFRAVPPATGI
VHQVNLEYLATVIATREVDGELVAFPDSLVGTDSHTTMINGLGVLGWGVGGIEAEAGMLG
QPLYFVTPEVVGFKLTGTLNAGATATDLALTVTQMLRKKGVVGKFVEFYGPGLSNISLAD
RATVANMAPEYGATMGFFPVDAETLNYMRQTGREEDLISLVETYTKAQGLFRTDETVDPV
FSETLELDLSTVVPSLAGPKRPQDRVELTAMKESFNNSLRTPIEKGGFGLSEEKIAASAP
VAYPNGEKATLKTGAVVIAAITSCTNTSNPSVMLGAGILAKKAVEKGLKKPAFVKSSLAP
GSRVVTQYLTDAGLIDSLDAIGFNVVGYGCTTCIGNSGPLPEETSKAIADEDLTVAAVLS
GNRNFEGRIHAQVKANYLASPPLVIAYALAGTVDIDLTTEPIGTGKDGQPVFLKDIWPSP
QEIAAAMDKAMNPALFRAEYGQVFTQNEAWNKIDVPTGDLYEWDEKSTYIQEPPFFQNLA
GEIAKIADIKAANTIALFGDSVTTDHISPAGNISPTSPAGLYLQANGVERKDFNSYGARR
GSHDVMMRGTFANIRIRNQVAPGTEGGVTKYLPTDEVMSIYDASMKYQADGTPLVVLAGK
EYGTGSSRDWAAKGTFLLGIKAVIAESFERIHRANLVGMGVLPLQFAGDQSWKSLGIDGT
ESFNIVGLSDDVQPGQRVKVEATKKDGSTFEFEVIVRLDSMVDVDYYRNGGILQTVLRQL
LDEGKPVNA
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
ttggctaacaaagatgcttacaaagtaaagtcatccctgcaagtaggcgacaagtctttt
gcttactatcgcctgcaagggttggaagaacaaggattgggcgatgtttccaaactgccg
ttctccattaaagttctgctcgaggctgctgtacgtcagttcgacggccgtgcgatcacc
aaagaacacgtacaacaattggcgacctggacaaaaggccgcgacgaaaaccaagaagtt
cctctcatgccagctcgtatcgttctgcaagacttcaccggtgtaccggctgtagttgac
ctggcagcgatgcgcatcgcgatgaagcgcgctggtggagatccaaaacgaatcaaccca
ttggttccagttgacctcgttatcgaccactccgtcatggttgacgatttcggtaacgcg
tccgctctggacaacaacatgaaattggaattcgaacgcaaccaagagcgctaccgcttc
ctgcgttgggcacaaactgcgtttgacaacttccgtgcggttcctccagctactggtatc
gttcaccaagtaaacttggagtacctcgcaactgtaatcgctactcgtgaagtagatggc
gaattggttgctttccctgactctctcgtaggtactgactcccacaccactatgatcaac
ggtcttggtgttcttggatggggtgttggtggtatcgaggcagaagcaggaatgctcggc
caacctctgtatttcgtaacgccagaagtagttggtttcaaactgactggcacactgaat
gctggtgcaactgcaactgacctcgctctgactgttacgcaaatgcttcgtaaaaaaggc
gttgtaggtaaattcgtggagttctacggaccaggcctgtccaacatctcgctggctgac
cgcgctaccgtagcaaacatggcacctgagtacggcgctacaatgggcttcttcccagta
gatgctgaaacactcaactacatgcgtcaaactggtcgtgaagaagacctcatctccttg
gttgagacttacaccaaagcacaaggcctcttccgtactgacgagactgttgacccagta
ttctccgaaacattggaactggatctgtccacagtcgtacctagcttggctggtccaaaa
cgtcctcaagaccgcgtagaactgactgctatgaaggaatccttcaataacagcctccgt
acgccgatcgaaaaaggcggatttggtctctctgaagagaaaatcgcagctagcgcacca
gttgcttatccaaacggtgaaaaagctacgctgaaaacaggtgctgttgtaatcgcagcg
atcacttcctgtaccaatacatcaaatcctagcgtaatgctgggtgctggtatcctggcg
aaaaaagctgtggaaaaaggcctgaaaaagcctgctttcgtaaaaagctccctggctcca
ggttcccgcgtagttacacaatacctgactgacgctggtctgatcgactccttggatgct
atcggattcaacgtagtaggttatggttgcaccacttgcatcggtaactccggtccattg
ccagaggaaaccagcaaagctatcgcagacgaagatctgacagttgcagcggtactctcc
ggtaaccgtaacttcgaaggtcgtatccatgcacaggtaaaagcgaactacctcgcttct
cctccattggttatcgcctatgcactggcaggtactgtagatatcgacctgactacagag
ccaatcggcactggcaaagacggtcaacctgtattcttgaaagacatctggccatctcca
caagagatcgcagctgcaatggacaaagcgatgaatcctgctctgttccgcgctgagtac
ggccaagtgttcacgcaaaacgaagcttggaacaaaatcgacgttccaactggcgacctg
tacgagtgggatgaaaaatccacgtacatccaagaaccgccattcttccaaaacctggct
ggagaaatcgctaagatcgcagacatcaaagcagcgaacaccatcgcactcttcggtgat
tctgtgacaactgaccatatctccccagcaggtaacatctcgccaactagcccagcaggt
ctgtatctgcaagcaaacggcgtagagcgcaaagacttcaactcctacggtgctcgtcgt
ggtagccacgatgtaatgatgcgcggtacatttgcaaacatccgtatccgcaaccaagta
gctcctggaactgagggcggcgtaaccaaatacttgccaactgacgaagtaatgtccatc
tacgatgcttccatgaagtatcaagcagacggtactccactcgttgtactggctggtaaa
gagtacggtactggttcttcccgtgactgggcagcaaaaggtacattcctcttgggtatc
aaagcagttatcgctgagagcttcgagcgtatccaccgtgctaacctggttggtatgggc
gttctgcctctgcaattcgctggtgaccaaagctggaagtccctcggcatcgacggtact
gagtccttcaacattgtaggtctctccgatgatgttcaacctggtcaacgcgtaaaagta
gaagcaacgaagaaagacggaagcactttcgaattcgaagtaatcgtgcgcctcgattcc
atggtagacgtagactactaccgcaatggtggtatcctgcaaacggttctgcgtcaattg
ctggatgaaggcaaaccagtaaacgcgtaa

DBGET integrated database retrieval system