KEGG   Brevibacillus brevis: BBR47_43520Help
Entry
BBR47_43520       CDS       T00879                                 

Gene name
yfmT
Definition
(GenBank) probable aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00627  Aminobenzoate degradation
bbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BBR47_43520 (yfmT)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BBR47_43520 (yfmT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: BAH45329
NITE: BBR47_43520
UniProt: C0ZI55
LinkDB All DBs
Position
complement(4600255..4601712)
Genome map
AA seq 485 aa AA seqDB search
MSILQTLDKQYINGEWRDGLGAKTLQDINPYNGEIIAEFKMANLEDIDAAYKAAANAKKE
WDEVNAYTKSRMLERAVRYIEEHEEEIIQIIIRELGGTRLKAFFEIGLVKDIIREAATFP
VRMEGKILPSPVDGKENRLYRIPAGVVGVISPFNFPFYLSMKSVAPALGAGNGVVLKPHE
HTPITGGTLIAKIFEEVGLPKGLINVVVTDIAEIGDGFVSHPIPRILSFTGSSQVGSHIA
QVAAKHFKKAILELGGNSALIVLEDADLQYAVNAAVFSRFTHQGQICMSANRVLVHQDVY
DKFLDLYVEKVSGLKVGDPNDPDTVIGPLINQRQVANLMATIDEAIREGAVPALKGEVKG
NVVEPIVLTGVTTDMSIASKELFGPAVCIMSFASEEEAIRMANETPFGLSGAIHTRDLER
GAQMAKRIETGMIHINDGTINDEPIVAFGGEKHSGLGRLNGQWSLEEFTTLKWISVQHKK
RQFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatccttcaaacactggacaagcagtacatcaatggggagtggcgcgacggactt
ggcgcgaagacattgcaagatatcaacccttacaacggggaaatcatcgcagaattcaaa
atggcaaatctggaggatatcgacgcggcttacaaggcggcagccaacgcgaaaaaagag
tgggatgaagtgaatgcctataccaaatcccgaatgttggagcgtgcagttcgctatatc
gaagagcatgaagaagaaatcattcagatcatcattcgtgaactaggtggaacccgactg
aaggcattttttgagatcgggcttgtgaaggatattattcgcgaagcggctacgttcccg
gtgcgcatggaaggaaaaattctcccttctcccgtagacggaaaggaaaatcgcttgtat
cggattcccgcaggagttgtcggtgtcatcagtccgttcaacttcccgttctatctgtcg
atgaagtccgtagctccagctcttggcgcgggcaacggtgtcgtcctcaaaccgcatgag
cacacgccaatcacgggtgggactctcatcgcgaaaatttttgaagaagtaggtctgccc
aaaggcttgatcaacgtcgttgtaacggatattgctgaaattggcgatgggtttgtctcc
cacccgattccgcgcatcctttcgtttacaggctctagccaagtaggaagccatatcgcg
caagtggcagcgaagcatttcaagaaggcgattttggagctaggtggcaatagtgccctc
attgttttggaggatgcggatctccagtatgccgtcaatgcagcggtattcagccgcttt
acccaccaaggtcagatttgcatgtcggctaaccgggttctggttcaccaagatgtatac
gataaattcctcgatctgtatgtggaaaaagtatctggtctcaaggtaggcgacccaaat
gatccagacacggtaatcggtccactcatcaatcaacggcaagtcgccaacctgatggca
acgatcgatgaggcgatacgcgaaggagccgttcctgcactgaaaggggaagtaaaagga
aacgtggtcgagccgattgttttgacaggagtgaccacagacatgtcgattgcatccaaa
gagctgtttggtccggctgtttgcatcatgtcgtttgcttccgaggaagaagcaattcgc
atggcgaacgaaacaccatttggattgtccggggcgattcatacccgcgatctggagaga
ggtgcccagatggccaagcgcattgagaccggcatgattcatatcaacgatggaacgatc
aatgacgaaccaattgtggcgttcggcggtgaaaagcattccggattgggacgcttgaat
ggtcaatggagcctagaagagtttactacgctaaaatggatttcggttcagcacaaaaag
cgtcaatttccgtactaa

DBGET integrated database retrieval system