KEGG   Brevibacillus brevis: BBR47_49060Help
Entry
BBR47_49060       CDS       T00879                                 

Gene name
proC
Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00330  Arginine and proline metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01130  Biosynthesis of antibiotics
bbe01230  Biosynthesis of amino acids
Module
bbe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BBR47_49060 (proC)
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BBR47_49060 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_Gly3P_dh_N NAD_binding_2 Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: BAH45883
NITE: BBR47_49060
UniProt: C0ZL56
LinkDB All DBs
Position
5159588..5160430
Genome map
AA seq 280 aa AA seqDB search
MSNQATAITEGRIGFLGAGSIVEAMLSGIGKKGLLPSERISVTNRNNMERLEQLANDYGV
TVTQDKFDVVRSSDILILAIKPKDAAEALLDLRGVVRSDQLIISVIAGVSTSLIGEWLGA
ECPIIRTMPNTSSAVGLSATGLCANPFVQEEHCELATKLFEAIGTVYEVAEEELDIITGL
SGSGPAYIYYLVEAMMGAGAKAGLDREMARQLTLQTVIGAAHMLLDTREEPSILRQKVTS
PGGTTQAGLEVLEAYQFQEAVTAAILRAAERSREMGAQYQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccaagcaacagcgattacagaagggcggatcggttttctcggtgcaggctcg
atcgtggaggccatgctttctggtatcggaaagaaagggttactcccttctgagcgtatt
tccgtcacgaaccgcaacaatatggagcgtttggagcagttggcaaatgactacggagta
actgttactcaggacaaatttgacgtagtccgttcttccgatattttaattttggctatc
aagccgaaggatgccgcagaggctttgctggatttgcgtggggtcgttcgttccgaccaa
ttgattatctcggtaatcgctggcgtctccaccagcttgatcggagagtggctcggtgca
gagtgcccgattatccgcacgatgcctaatacatcgtctgcggttggtttgtccgctacc
ggactgtgcgcaaatccgtttgtccaggaagagcactgcgagctggctaccaaacttttc
gaagcaattggcaccgtatatgaagtcgccgaggaagagctggacatcattactggattg
tctggaagcggccctgcttatatttactatttggtggaggccatgatgggggcaggtgcc
aaagcgggactagatcgggaaatggcgcgccaattaacgctgcaaaccgtgattggcgcg
gcacatatgctgctcgatacacgcgaagagccttcgattctccgccaaaaagtaacgagt
ccgggcggaacgacccaggcagggctggaagtattggaagcctatcagtttcaggaggct
gtcacggcagccatcctgcgtgctgccgaaagatcgcgggagatgggggcacaataccag
taa

DBGET integrated database retrieval system