KEGG   Brevibacillus brevis: BBR47_54480Help
Entry
BBR47_54480       CDS       T00879                                 

Gene name
atpD
Definition
(GenBank) ATP synthase beta chain
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00190  Oxidative phosphorylation
bbe01100  Metabolic pathways
Module
bbe_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BBR47_54480 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:bbe00194]
    BBR47_54480 (atpD)
Enzymes [BR:bbe01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     BBR47_54480 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     BBR47_54480 (atpD)
Photosynthesis proteins [BR:bbe00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   BBR47_54480 (atpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N RsgA_GTPase T3SS_ATPase_C AAA_19 ATPase AAA_30 TrwB_AAD_bind AAA_7 ABC_tran
Motif
Other DBs
NCBI-ProteinID: BAH46425
NITE: BBR47_54480
UniProt: C0Z776
LinkDB All DBs
Position
complement(5754064..5755473)
Genome map
AA seq 469 aa AA seqDB search
MANGRVVQVMGPVVDVEFDRGHLPAIYNAIKIQHKAQSAGERDIDLTVEVATHLGDNLVR
TVAMSSTDGLVRGMEAVDTGAAISVPVGAITLGRVFNVLGEPIDLQELGQVDRRDPIHRK
APEFVDQATTVEILETGIKVIDLLAPYIKGGKIGLFGGAGVGKTVTIQELINNIAQEHGG
ISVFAGVGERTREGNDLYHEMKDAGVLPKTAMVFGQMNEPPGARLRVALTGLTMAEYFRD
EEGRDVLLFVDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVT
SIQAIYVPADDYTDPAPATTFAHLDATTNLERSIAELGIFPAVDPLASTSRALAPDIVGQ
EHYDVARSVQKILQRYKELQDIIAILGMDELSDDDKQVVGRARRIQRFLSQSFHVAEQFT
GNPGQYVPLKETVRSFKEILEGKHDHLPEGAFLYVGTIEEAVEKAKKMA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatggacgtgtggttcaggtaatgggtccggttgttgacgtcgagttcgaccgc
ggacacctgcctgccatttacaatgcgatcaagattcaacataaagcacaaagtgccggt
gagcgcgacatcgacttgactgttgaggttgctactcatttgggcgataacttggttcgt
accgttgcaatgtcttccactgacggtttggttcgtggtatggaagcagttgataccggt
gcagctatctccgttccagtgggtgcaatcaccctcggacgcgtatttaacgtattgggt
gagccgatcgacctgcaagaactcggtcaagtagatcgtcgtgacccaattcaccgtaaa
gctcctgagttcgtagaccaagcaacgactgttgagatcctggaaacaggtatcaaagtt
attgacctcttggctccgtacatcaagggtggtaagatcggtctatttggtggtgcgggt
gtaggtaaaaccgttactattcaagagctgatcaacaacatcgcgcaagagcacggtggt
atttccgtattcgctggtgtaggtgagcgtacccgtgaaggtaacgacctgtaccacgag
atgaaagacgcaggcgtactgccgaaaaccgcgatggtattcggtcagatgaacgaaccg
cctggtgcacgtcttcgtgtagcgttgactggtctgactatggcggaatacttccgtgat
gaagaaggccgcgacgttcttctctttgttgataacatcttccgctttacacaagcgggt
tccgaagtttctgctctcttgggccgtatgccatctgcggtaggttaccaaccaacattg
gctaccgaaatgggtcagctgcaagagcgtattacttccacgaaaaaaggttccgtaacg
tccattcaagcgatctacgtaccagcggatgactacactgacccggctcctgctactacg
tttgctcacttggacgctacaacgaacttggagcgttccatcgctgagctgggtatcttc
cctgcggtagacccactcgcatccacttcccgtgctctggctcctgatattgtaggacaa
gaacactatgatgtggctcgtagcgttcaaaaaatcctgcaacgttacaaagaactgcaa
gatatcatcgcgattctcggtatggacgagttgagcgacgacgacaagcaagtagttgga
cgcgcacgccgcattcaacgtttcttgtcccagtccttccacgttgccgagcagttcact
ggtaacccaggccaatacgtgccattgaaggaaactgttcgcagcttcaaggaaatcctc
gaaggtaagcatgaccacctgccagagggcgcgttcctgtacgtaggtacaattgaagaa
gcggtagaaaaagcgaagaaaatggcgtaa

DBGET integrated database retrieval system