KEGG   Brevibacillus brevis: BBR47_56550Help
Entry
BBR47_56550       CDS       T00879                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bbe  Brevibacillus brevis
Pathway
bbe00010  Glycolysis / Gluconeogenesis
bbe00620  Pyruvate metabolism
bbe01100  Metabolic pathways
bbe01110  Biosynthesis of secondary metabolites
bbe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBR47_56550
   00620 Pyruvate metabolism
    BBR47_56550
Enzymes [BR:bbe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BBR47_56550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAH46632
NITE: BBR47_56550
UniProt: C0Z8K5
LinkDB All DBs
Position
5973823..5975343
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQAGSKVTFKNRYENYIGGNWVPPVKGEYFENVSPVTGKVFCEVARSTAEDIEL
ALDAAHEAKDAWGRTSVAQRANMLLKIADRMEANLEMLANAETWENGKPVRETLAADIPL
AIDHFRYFAGAIRAQESTLAEIDNDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASILVLMELIGDLLPPGVVNVVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNIIPVTLELGGKSPNIFFSDVAANDDAFFNKAIEGFVLFALNQGEV
CTCPSRALIHESIYDQFMERALQRVANIKQGNPLDTDTMIGAQASLEQVEKILSYLDIGK
QEGAECLIGGARAQLAGELEGGYYIQPTVFKGHNKMRIFQEEIFGPVVSVTTFKDTEEAL
AMANDTLYGLGAGVWTRDTNTAYRMGREIQAGRVWTNCYHAYPAHAAFGGYKMSGIGRET
HKMMLSHYQQTKNLLVSYSDQALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgctcagcccggtcaagccggttctaaggtgactttcaaaaatcgttatgaa
aactacatcgggggtaattgggttccgccagtaaaaggtgagtatttcgaaaacgtatca
cctgtaacaggcaaggtcttttgcgaggtagcccgctcgacagccgaagatattgagctg
gcactggacgctgcccatgaggcaaaagacgcgtggggtcgtacctctgttgcacagcgc
gcaaatatgttgttaaaaatcgcggatcggatggaagcaaatctggagatgctggcaaac
gcagagacgtgggaaaatggcaagcccgttcgtgaaacactcgctgccgacatcccgctg
gcaattgaccatttccgctacttcgccggagcgatccgcgcgcaagaaagtacactcgcc
gaaatcgataacgatacggtcgcttatcatttccatgagccactcggtgtcgttggtcaa
attattccctggaacttcccgctcctcatggctacatggaagctggctccagccttggct
gcgggcaactgcgtcgtcctcaagccagcggagcaaacacctgcatccatcttggtgctg
atggagctgatcggcgacctgctccctcctggcgtcgtcaacgtcgtgaacggctttggt
ctggaagcgggtaaaccgctcgcttcaagcaaccgcatcgcgaaaatcgcttttacaggt
gaaacgacgacagggcgcttgatcatgcaatacgcttcccaaaatatcattccggtgacg
ctggagctgggcggaaaatcgccaaacatcttcttctcggatgtagctgcaaatgacgat
gccttctttaacaaagccattgaaggattcgtactgtttgcgctcaaccaaggcgaggtt
tgcacatgcccatcccgcgcgctcattcacgaaagcatttacgaccaattcatggagcgt
gccctgcaacgcgtagccaatatcaagcaaggaaatccgctcgatacagatacaatgatc
ggcgcacaggcttccttggagcaggtagaaaaaatcctctcctacctggatatcggcaaa
caagaaggagccgaatgcctgattggaggcgctcgtgcacagcttgcaggtgaactcgag
ggcggctactacatccagccaactgtctttaaaggccacaacaagatgcgtatcttccaa
gaggaaatcttcggtccagtcgtctccgtaacgaccttcaaggatacagaagaagcgctc
gctatggcaaatgatacgctgtatggcttgggtgctggtgtatggacacgcgacacgaac
acagcctaccgcatgggccgcgaaatccaggctggtcgcgtatggaccaactgctaccat
gcttatccggctcacgcagcgtttggcggctataaaatgtccggtatcggccgcgagaca
cacaaaatgatgctgtctcactatcaacaaacgaaaaacctgctggtcagctacagcgat
caagctctgggcttcttttga

DBGET integrated database retrieval system