KEGG   Brevibacillus brevis: BBR47_58750Help
Entry
BBR47_58750       CDS       T00879                                 

Definition
(GenBank) two-component hybrid sensor and regulator
Organism
bbe  Brevibacillus brevis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg His_kinase HATPase_c_3 HisKA 7TMR-DISM_7TM HATPase_c_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: BAH46852
NITE: BBR47_58750
UniProt: C0Z9Z8
LinkDB All DBs
Position
6225779..6228853
Genome map
AA seq 1024 aa AA seqDB search
MKTVAWKWTKMIVVALLVVTAVRLLWMSFLTTFDYAEKPVAVQGVLDLRGWEFSEYQTLR
LDGEWEFFPSQFIEGNGLKKPEGQTYLQVPNKWDEAFVHEQGLSDSFHFGTYRLRILLDP
EQEQTLGFRINELRTASTVYANGKLVAQAGQPATSNIEHQARNIPYTVKLTPQQGQVELL
IHVSNDAGAGGITKPIRFGTIEAVQMRTILSISLQLLLLVVFLIHSLYALLLYFLGARNK
GLVYFSLVMVCGIFTVVTADDKLLFVWLQFDYDWTVKLTYLVYVGAVAFIPPLFHHLLPA
YLNRRILQGFSGLCSLYAIFILLVPAGTILAMIRMLSIVLLLSVIISAYILWKAIRDKED
IIFLLLACLFVGVNVIWTIAYSILGWEFIHYPFNLIFAVLAFAAYWFRRFFRATTETKHL
AEKLQQEDKRKDEFLVNTSHELRNPLHGIINITQAIIEDTNNPLHEEHKKRLDILLHVSR
RLTLMLDDLLDVTRLKENSIRLHEKKLNLQSIFAGVFDMAKLMLDGKPIALQVEIDDSFP
AVRGDENRLIQILFNLVHNAIKFTDEGTITIRATTSNGFAQIQVEDTGVGVEEKALQTIF
QPYEQAELNAIRASGGFGLGLHISKQLVELHGGTLSVQSTLGKGSAFTFTLPLASDSVLI
EENSAQTWMQTSLEMAAATTDRIITSTETVSSMNRRARIIVVDDDSINLNILSKMLESDQ
YEVSTATSAQQALSILERNPVDLVISDVMMPHVSGYELTRIIRERFSVLELPVLLLTARS
RSEDIIAGFQAGANDYVKKPVDAWELKARVKALTEFKISFDERLRMEGAWLQSQIEPHFL
FNALNSIAALGLQDFTKMQTLLEEFSNYLRLSFDFHNSEPVISLHDELDLVRSYLYIEKQ
RFGDRLQVEWDLDPDLDFCLPPLSIQPLVENAIKHGLMQRTSGGTVWIHIKDNEEYFEIS
IQDDGEGIAEEDLNQLFSQTRHGKKRASVGLRNIERRLRQLYNQGLTINSSPEQGTIVTF
GIPK
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtcgcctggaaatggacgaaaatgatcgttgttgctctactagtggtaaca
gccgttcgcttactctggatgagtttccttaccacctttgactacgctgaaaaaccagtg
gctgtacaaggtgtgcttgatttacgcggatgggaattctcggaataccaaacattacgg
ttggatggggagtgggagttcttcccttctcagttcatagagggaaacggtctaaagaaa
cctgagggacagacataccttcaagtacccaataagtgggatgaggcatttgttcatgag
cagggtttatcggactctttccacttcggcacctatcgactacgcatcttgcttgatccg
gaacaggaacagacacttggtttcaggatcaatgagcttcgaactgcctcgaccgtctat
gccaatgggaaattagtggcccaggcgggacaaccggcaaccagcaacatagagcatcaa
gcacgcaatattccctatactgtcaaactgacaccacaacaaggccaagtagagttgctt
atccatgtttccaatgatgccggggcaggaggaattacaaaacctattcgcttcggtacg
atagaagctgtacagatgcggacgatcctctccatcagtttgcaactattattactcgtc
gtgtttctgatccatagtttatatgccttgctcctgtacttcttgggtgccagaaataaa
ggcttggtatatttctcattggtcatggtttgtggaatatttaccgtggtgacagccgat
gacaagttattatttgtctggttgcagttcgattatgattggacagttaagttgacgtat
ctcgtctatgttggtgcagtcgccttcatccctcccttgtttcatcatctgcttcctgct
tatctaaacagaaggattttacaaggtttcagtggcttgtgcagcttatacgccatcttc
atcctccttgtacctgctggaactatcttagcgatgatcagaatgctctctatcgtgctg
ctcctatccgtcattatttctgcttacatactctggaaggccattcgggacaaggaagac
attatatttctcctgctagcttgcttgtttgtaggggtgaatgtgatctggacgatcgct
tatagcatattaggatgggaatttattcactaccccttcaacctgatctttgccgtactt
gcttttgcggcatattggtttagacgatttttccgggcaacgactgagacgaaacatctt
gctgagaaattacagcaagaggataagcgcaaggacgaatttttggtgaatacttcccat
gaactgagaaatccattacatggcatcatcaatatcacacaagcgattatcgaggataca
aacaatccccttcatgaagaacacaaaaagcgtctggatattctcctgcatgtcagcaga
cgtctgacactcatgctagatgatttgctggatgtaacccgattaaaggagaacagcatt
cgcctgcatgagaaaaaattaaacctgcagtctatcttcgctggtgttttcgatatggcg
aaactaatgctggacggaaaaccgattgctttacaagtggaaatagacgattcgtttcct
gctgttcggggagatgaaaaccggctgattcaaattctttttaatttggtgcataatgcc
attaaatttacagatgagggaactatcacgattcgcgcgacaacgtctaacggatttgcg
cagatccaagtagaggatactggggtcggtgtcgaggaaaaggctctacaaactattttt
caaccttatgaacaagcggaactgaatgcaatcagagctagtggcggattcgggcttggc
ttacacatttccaaacagttagttgagctgcacggcggtactctatcggttcagtccacc
ctgggaaaaggctctgcctttacttttacactcccacttgcttcagattccgttctaata
gaagaaaacagcgctcagacatggatgcagacttcactagaaatggccgctgcaacgact
gatcgaatcattacatcgacagaaaccgtttcttctatgaatagaagagcaagaattatc
gttgtagatgacgacagtattaacctgaacatccttagcaaaatgcttgaatcagatcaa
tacgaagtaagcacggcaaccagcgctcagcaagccctgtccatactggaacgtaacccg
gtcgatctggtcatctcagacgtcatgatgcctcacgtatccggctatgaacttacacgc
atcattcgggaacgattctctgttttagaactgcctgtcctgctcttgaccgcgcgcagt
cgttccgaggatattatcgccggctttcaagcaggggcgaacgactatgttaagaaaccc
gtcgatgcttgggaattaaaagcaagggtaaaagccttaacagagtttaaaatatccttc
gatgaacgtttgcgtatggaaggagcatggttacaatcacaaattgaacctcattttttg
tttaacgcattaaattcaattgccgccttgggacttcaggacttcacgaaaatgcagaca
ctgcttgaagagtttagcaactatttgcgtttgagctttgactttcataattctgaaccc
gttatttcgcttcacgatgaacttgatcttgttcgatcttatttgtatatcgagaagcaa
cgatttggcgatcgcttgcaagtggaatgggatctggaccctgatctcgatttttgctta
ccacccttatccatacaaccgctagtcgaaaatgccatcaaacacggcttaatgcaacgc
acaagtgggggaactgtctggattcacatcaaagacaacgaggagtatttcgaaatctca
atccaagacgatggggaaggcatagcagaggaagatctgaatcaactattcagccaaaca
aggcatggcaagaaaagagcaagcgtaggtctgcgaaatattgaacggcgactaagacaa
ctatataaccagggattaacgattaatagctcacctgaacaaggtacgatcgtcactttt
ggaatccccaaataa

DBGET integrated database retrieval system