KEGG   Bacillus beveridgei: BBEV_0576Help
Entry
BBEV_0576         CDS       T05114                                 

Gene name
hisI
Definition
(GenBank) Phosphoribosyl-AMP cyclohydrolase / Phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00340  Histidine metabolism
bbev01100  Metabolic pathways
bbev01110  Biosynthesis of secondary metabolites
bbev01230  Biosynthesis of amino acids
Module
bbev_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BBEV_0576 (hisI)
Enzymes [BR:bbev01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BBEV_0576 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BBEV_0576 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG FCD
Motif
Other DBs
NCBI-ProteinID: AOM81969
UniProt: A0A1D7QSK7
LinkDB All DBs
Position
655160..655795
Genome map
AA seq 211 aa AA seqDB search
MTTIQFDDKGLVPAIVQDAQSKQVLTLAYMNEESLTKTKETGETWFYSRSRQELWHKGGT
SGNTQRVTEIRYDCDQDALVILVEPAGPACHKGDVSCFSDVLWKQESTGTPEQNRYAIIE
ELEALLAKREAERPEGSYTTYLFDEGVDKILKKIGEEAGEIIIAAKNRDKEELTWETADF
LFHLLVLLREQKLPLDAVLQRLQDRHAGKKE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgatacaatttgacgacaaaggtctggtaccggcgatcgtgcaggacgcccag
tccaaacaggtgctgaccctggcctatatgaacgaagaatccttaacgaaaacaaaggaa
accggagaaacctggttctacagccgttccaggcaggaactgtggcataaaggtgggact
tccgggaacacgcagcgcgtgacggaaatccgctacgactgcgatcaggatgcactggtc
attctggtggagccggcgggaccagcgtgtcataagggagatgtcagctgcttcagtgat
gtcctctggaaacaggagtctacgggtacgcctgaacaaaaccggtatgcgattattgaa
gagctggaggcacttctggcaaaacgggaagcggagcgtccggaagggtcgtacaccacg
tatttgtttgacgaaggcgtggataaaattctcaagaagatcggtgaagaagcaggcgag
atcatcatcgctgcgaagaaccgcgacaaggaggagctgacgtgggaaacggcggatttt
ctctttcatcttctcgttcttctccgggagcaaaagctgccgctggacgccgttttacag
cggttgcaagaccgccatgccgggaaaaaagagtag

DBGET integrated database retrieval system