KEGG   Bacillus beveridgei: BBEV_1559Help
Entry
BBEV_1559         CDS       T05114                                 

Definition
(GenBank) Methionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00270  Cysteine and methionine metabolism
bbev00450  Selenocompound metabolism
bbev01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BBEV_1559
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BBEV_1559
Enzymes [BR:bbev01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     BBEV_1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Met_gamma_lyase Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AOM82920
UniProt: A0A1D7QV82
LinkDB All DBs
Position
1669638..1670819
Genome map
AA seq 393 aa AA seqDB search
MTRHIETKMIHSHFNRKQHEGSLSHPLYQTSTFVFDSAEQGEARFAGDESGYMYSRLGNP
TVNELETKMADLEDGEAAVAFGSGMGAVTGVLMHLLNSSDHVLVTEGVYGCTYGFLELFQ
DKYGIQYDLIAMDNEAQLKKYLRPETKVLYVETPINPTMKLVDLTMVIEFAKENGLKVVV
DNTFSSPYLQKPITLGADFVVHSATKYIGGHGDVIAGVAIGPEEEMRTIRMTSLKDVGAV
LGAFDAWLLLRGLKTLAVRMDRHCDNAELIFNQLKDSRFIEDIIYPGDENYKQYDIARNQ
MKKPGGMISFEIKGGKTAAQRFLNELKLCKVAVSLGDTETLIQHPASMTHAVVPAENRMK
MGIRDSLLRISVGLEHHEDIWADIHQALEKSAE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggcatattgaaacgaaaatgattcacagtcattttaatcgaaaacagcatgaa
ggcagtctttcacatcccttatatcagacatccacatttgtatttgatagtgcagaacaa
ggggaagcgcgttttgcgggagatgaatcaggctatatgtattcacgccttggaaatccg
acagtcaatgaattggaaacaaaaatggctgacttggaggatggggaagctgcggttgca
tttggctcaggaatgggagcggtaaccggagttctgatgcatttattaaacagtagcgat
catgtactcgtaactgaaggtgtttatggatgtacgtatggctttttggaattgttccag
gataaatacggcattcaatatgatttaattgctatggacaatgaagcacaattaaagaaa
tacttgcgtcctgaaacaaaagtactttatgtggaaaccccaatcaatccaacaatgaag
ttagtagatcttactatggttatagagtttgcaaaagagaacggtttaaaagttgtcgtg
gataacacattttcatcaccatacttacaaaaaccgattacgttaggtgcggattttgtt
gtgcatagtgctacaaaatatatcggaggtcatggggatgtaattgcaggggtagccatc
ggccctgaagaagaaatgagaacgatccgtatgacttcattaaaagatgtgggcgcagta
ctgggtgcttttgatgcgtggctgcttttgagaggtctgaaaacgttggctgttcgcatg
gatcgtcattgtgataatgcggagcttatttttaatcaattaaaagattcacgatttata
gaggatattatttatccaggtgatgagaactataagcaatacgacatcgccagaaatcag
atgaaaaaaccaggaggaatgatcagtttcgaaatcaaaggtgggaaaactgcagctcag
cgttttctgaatgaattgaaactatgtaaagtagccgtgagtcttggcgatacagaaact
ctgattcagcatccagcgtcaatgacgcatgctgttgttcctgcagaaaacagaatgaaa
atgggtattcgagattctctcttaaggatatcggttggactggagcatcatgaagatatc
tgggccgatattcatcaagctttggaaaagtctgctgaatga

DBGET integrated database retrieval system