KEGG   Bacillus beveridgei: BBEV_1875Help
Entry
BBEV_1875         CDS       T05114                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bbev  Bacillus beveridgei
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bbev01001]
    BBEV_1875 (prkC)
Enzymes [BR:bbev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBEV_1875 (prkC)
Protein kinases [BR:bbev01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBEV_1875 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo Pkinase_fungal Haspin_kinase TMEM190 RIO1 YrbL-PhoP_reg Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AOM83236
UniProt: A0A1D7QW47
LinkDB All DBs
Position
complement(2010342..2012363)
Genome map
AA seq 673 aa AA seqDB search
MPQKRVSDRYEIIRAVGGGGMADVYLAKDLILDRDVAVKVLKSQFAEDEEFIRRFRREAH
SAAAMSHPNIVNIYDVGEEENEYYIVMEYVEGQTLKEYISANQRLSPEETVRILRQVTSA
VAHAHDNHIVHRDIKPQNILISPNGTAKVTDFGISRAISDATITHTNSVLGSVHYLSPEQ
ARGGYVTYQSDLYSLGVVAYEMLTGHVPFTADTPVSIAIKHMQDTFPSVKEKLSFVPQSL
ENLIMTAVAKEPQNRYLSGHTMLADLDTILDPSRVNEAAVVPVPFDENATRAMPAVSSKE
SLADNDQTKVSSGAVNQDTVSYERDKGKSNQKKRSKAFWVKTGTIIGLVMLAVILFLFWW
IPSLLHVEDVEIPDNLIGEAFDEVEEQLIDLNLVVEADYRFDDEIEEGHVISHNPEAGRM
VKEESTIRVMVSEGPEPMQMIDVTGETRERALNLLEEFDEVEIQYRETTDTNPDTVLEQD
PEAGEEVIPAVTSVTLTISEYPVFTMPNLADMNRDEVLELLENEPLINLSFDEDYHPSTE
EGKVISQNPGRGARIDEPTTVNVVFSMGPEPEEEEEPEEPVRVTVPFEVSIPEIEEEVND
EEPERYRVQISVTDMNSQVPRQVIDREITETTTFDVPMSVEPGESGFLILVVDGEEFDDS
PYEYTYEQLSDMQ
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaaagcgagtgagcgaccggtatgaaatcatccgtgcagtagggggaggcgga
atggcagatgtctatcttgccaaagatttgatcctcgatcgcgatgttgcagtgaaagtg
ctcaaaagtcaatttgcagaagacgaagaattcattcgtcgtttccgaagagaagcgcac
tcggctgcggcgatgtctcacccgaatattgtaaacatctatgatgttggagaagaagag
aatgaatactatattgtgatggaatatgtggaaggtcagacgttgaaggaatatatatca
gcgaatcagaggctttctccggaagagacggtacgtattctccgacaggtcacttctgca
gtggctcatgcacacgacaatcatatcgtgcatcgggatatcaaaccgcaaaatattttg
atctccccgaatggaacagcaaaagtaaccgactttggtatttcaagggctatcagtgat
gctaccatcacccacacgaattccgtattgggatctgttcactatttgtcacctgaacag
gcgagaggtggatacgtcacctatcaatccgacttatactcactgggcgtggtcgcctat
gaaatgctgacaggtcatgtcccattcactgcagatacaccagtttccatcgcaatcaag
catatgcaggacacgtttccatcagtgaaagagaaattatcattcgttccgcaaagtctt
gagaatctcatcatgacagctgtagcaaaagaaccacaaaaccgttatttatcaggacat
acgatgctggctgacctcgatacgatcttggacccttcgagagtaaatgaggcagccgtt
gtaccggtgccgtttgatgaaaatgctacgagagcaatgcctgcagtcagttctaaagaa
agtcttgcagataacgatcaaacaaaggtgagctctggagccgtgaatcaggatacagtg
agttatgaaagagacaaaggaaagtccaatcagaagaagcgatcaaaagctttttgggtg
aaaacgggtacaatcatcggtcttgtgatgctggctgtgatcttgtttttgttctggtgg
attccttcacttttgcatgtggaagatgtggaaattcctgataacctgataggtgaggcg
tttgacgaagtcgaagaacaattgatcgatttaaacctggttgttgaagccgactaccgg
tttgatgatgaaatcgaagaaggtcatgtcatcagtcataatccagaggccggccggatg
gtgaaggaagaatccacgattcgtgtgatggtcagtgaaggcccggagccaatgcagatg
attgatgtgactggtgaaacaagagaacgtgccttgaatttgctggaagaattcgatgaa
gttgaaattcaataccgtgaaacaaccgatacgaatccggatacggttttagaacaagac
ccggaagctggagaagaagtgattccggccgtcacatccgttacgttgaccatcagtgaa
tatcctgtgtttactatgccgaatcttgctgatatgaaccgtgacgaggttcttgagctt
cttgaaaatgaaccattgattaatttgtcgttcgacgaagactatcatccttcaacagaa
gaaggaaaagtaatttctcaaaacccgggtcgtggagcacgcatcgatgaaccgacaaca
gtgaatgtggttttcagtatgggccctgagcctgaagaggaagaagaacctgaagaaccc
gtcagagtcacagtaccttttgaagtctcaattcctgaaatagaagaggaagtgaatgat
gaagagccagaacgttaccgcgttcagatttcggttacagatatgaactcacaagttcca
agacaggtgattgatcgtgaaatcacagagactacaacatttgatgtaccgatgagtgtg
gaaccaggagaatcaggatttttgattctcgtagttgatggtgaagaattcgacgattct
ccttatgaatatacctatgagcaattatcagatatgcagtaa

DBGET integrated database retrieval system