KEGG   Bacillus beveridgei: BBEV_2518Help
Entry
BBEV_2518         CDS       T05114                                 

Definition
(GenBank) Type II/IV secretion system protein TadC, associated with Flp pilus assembly
  KO
K12511  tight adherence protein C
Organism
bbev  Bacillus beveridgei
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bbev02044]
    BBEV_2518
Secretion system [BR:bbev02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   BBEV_2518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF
Motif
Other DBs
NCBI-ProteinID: AOM83857
UniProt: A0A1D7QXW4
LinkDB All DBs
Position
complement(2690327..2691247)
Genome map
AA seq 306 aa AA seqDB search
MAIITYALTMLFIMYGLYLLKKERVKVHEERIAAIFNPERTAAVEAPFQEEELQGSLSKR
ILKPFWMKVRRLFKQRTSDKQFQKLEVKLEEAGNPMKMTVVEFRIAKLVVATVITGVFAL
LGFAASGTVMGITLYAGVGFLIAQYVPSFYLKSKTAERKKSAVKELPDFLDLLTVSIEAG
LGFDAAMSKVVAKKEGTLSTEFQRCLEEIRLGKTRREALTGVKKRLNVDDIHAFIGSIIQ
AEQLGIGMVQVLRIQSDEVRARRKQRAEESAMKAPIKMMFPLVLFIFPGIFIILLGPAVI
QILETF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccattatcacttatgccctgaccatgctcttcattatgtatggcttgtatttactg
aaaaaagaacgtgtgaaagtccatgaggaacggattgccgcgatttttaatccggagcgg
acggccgcggtggaagcgccttttcaggaggaagagctgcagggaagtttatcaaagcgg
atcttgaaaccgttttggatgaaggtaagacggctgtttaaacagcggacatccgataaa
caatttcaaaagctcgaagtgaagcttgaagaagcgggcaatccgatgaaaatgactgtc
gttgaattcagaatcgccaagctggtggttgccaccgtcattaccggtgtttttgcatta
ctaggttttgcagccagtgggacagtcatgggaatcactctttacgcaggcgtcggtttt
ctgattgcccaatatgttccctccttctatttgaagagtaaaacggcggaacgcaaaaaa
tcagccgttaaggaactgccggattttctcgatctgttaaccgtcagcattgaagccggc
cttggttttgacgcagccatgagtaaggtggttgcgaaaaaagagggaaccctgtcgacg
gaattccagcggtgtctggaggaaatccggcttggcaaaacccggcgagaagcactgacc
ggtgtcaaaaagcgcttgaatgtggatgatattcatgcgttcatcggcagcatcatccag
gcagaacagctggggatcgggatggtgcaggtgctgagaattcaatcggatgaagtgaga
gcgaggcgaaagcagcgggcggaggaatcggccatgaaagctccgatcaaaatgatgttc
cctctcgtcttgtttatctttcccgggatctttattattcttctcggaccggccgtgatt
caaattctcgagacattttaa

DBGET integrated database retrieval system