KEGG   Bacillus beveridgei: BBEV_2813Help
Entry
BBEV_2813         CDS       T05114                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bbev  Bacillus beveridgei
Pathway
bbev00473  D-Alanine metabolism
bbev01100  Metabolic pathways
bbev01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BBEV_2813 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BBEV_2813 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbev01011]
    BBEV_2813 (alr)
Enzymes [BR:bbev01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BBEV_2813 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bbev01011]
 Precursor biosynthesis
  Racemase
   BBEV_2813 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AOM84138
UniProt: A0A1D7QYT0
LinkDB All DBs
Position
complement(3006959..3008218)
Genome map
AA seq 419 aa AA seqDB search
MGNGDNRMKEMKLSDGRMSESIGQMEDNLMDVTHPFYRDTWAEINLNAIHDNVWAINRSL
PEETEMMAVVKANAYGHGAVDVAREALAAGATYLGVAILDEAIALRKAGVDAKILVLGYI
RAEDILIASELNIAVTVFQLDWLKQAASILEAAGKDIVCHVKLDSGMGRIGLRKEAEIRE
LAHALKTMDEFDVEGLYTHMATADELSSDYYAVQKERFITMISWFEETLERTVGIRHCAN
SASALRFHEEICNLVRVGISMYGMPPSVEMTPVMPVKLTQAMSLHSRITHVKQMEPGEGI
SYGMSYKTKGNEWIATIPIGYADGWIRAHQSGDVLVNGKRAKIVGRICMDQMMVLLEEPV
EPGTVATLIGENQGGFISMDEVAGRIGTISYEIPCTLSYRVPRAVRKDGRLLYVHNDIF
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacggtgataatagaatgaaagaaatgaagttatccgatggacggatgagtgaa
tcaattggacagatggaggacaatttaatggatgttacacaccctttttaccgggatacc
tgggcagaaatcaatttaaatgctatacacgataatgtatgggcaatcaatcgctcttta
ccggaagaaaccgaaatgatggcagtggtcaaggcgaatgcctatggacatggagcggtt
gatgtagcgagggaagccctggctgcaggggccacgtatctcggtgtggcaattcttgat
gaagcgatcgctcttcggaaagcaggcgtggacgccaaaattctcgtacttggatacatc
cgggccgaggacattttaattgcatccgagctgaatattgctgtcactgtctttcaattg
gactggttgaagcaggcggcttcgattctcgaagcggcagggaaagacattgtctgtcat
gtgaagctggattcgggaatggggcggatcgggcttcgcaaggaagcggaaatacgcgag
ctcgcccatgcactgaaaacgatggatgagtttgatgtggaaggcctctatacgcatatg
gccacagcggacgagttgagcagcgactattatgccgttcagaaagaacgattcattacg
atgatcagctggttcgaggaaacactggaacgaaccgtggggatccgccactgcgcgaac
agcgcctcggcccttcggtttcacgaggagatctgtaatctggtcagggtaggcatctcc
atgtatggcatgccgccttctgttgagatgacccccgtgatgccggtcaagttaactcag
gcaatgtcgctgcacagccgcattacccatgtgaaacagatggaaccgggtgaaggaatc
agctatgggatgagttataagacgaaggggaatgaatggatcgcgacgattcctattggg
tatgctgatggctggatcagggcgcatcagtcaggagatgttctggtaaacgggaagcgg
gctaagatcgttggccgcatctgtatggatcagatgatggttctattggaggaacccgtt
gaaccgggcacggttgctacgttgatcggtgaaaatcaaggcggatttatctcaatggat
gaagtggccggccggatcggaacgatcagctatgagatcccttgtacgctgagttaccgg
gtgcccagagcggtgcgtaaagatggccggttattatatgtgcataatgatattttctaa

DBGET integrated database retrieval system