KEGG   Bacillus beveridgei: BBEV_2943Help
Entry
BBEV_2943         CDS       T05114                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bbev  Bacillus beveridgei
Brite
KEGG Orthology (KO) [BR:bbev00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBEV_2943 (ahpF)
Enzymes [BR:bbev01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BBEV_2943 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA Thioredoxin_3 FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Thi4 Glutaredoxin NAD_binding_8 NAD_binding_9 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AOM84268
UniProt: A0A1D7QZ42
LinkDB All DBs
Position
3148267..3149823
Genome map
AA seq 518 aa AA seqDB search
MALDTSIKQQLNQYLELIERDLTLKLDAGSDEASRKLSDFVHEVAGMTPRIHVETASLSR
TPSFSVNRRGEDSGVAFAGIPLGHEFTSFVLAVLQVSGRAPKVDEDTLTQMKHLEGTFSF
ETYVSLSCQNCPEVVQALNMLSAVNPGVSNTMIDGAVFKQEVEDRDVMAVPAVYLNGEFF
GGGRMTIEDIFSKLGQGTDAKALNEKDPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVQDTLSIENFISTKKTEGPKLVASLEEHVRDYEVDIMKSQKVQSLEKKDRFELTLE
NGATLTSKSVILATGARWRNVGVPGEEEFRNNGVAYCPHCDGPLFEGKDTAVIGGGNSGV
EAAIDLAGIVNHVYLLEFLPELKADEVLQKKLHSLDNVTVITNAKTTEITGDNKVNGLSY
QDRVTDEEKHIPLEGVFVQIGLVPNTDWLDDSVEKTRMGEIVVNQHGQSSMPGLFAAGDC
TNSPYKQIIISMGSGATASLGAFDYLIRAQEPALTVSS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgacacatcgattaagcaacagctcaaccaataccttgaactcatcgagcgt
gatctgacactgaaactggatgccggatcagacgaggcttcaagaaaactgtcagacttc
gtccatgaagtggccgggatgaccccccgcattcacgtggagacagcttctctgtcacgg
acaccaagcttttctgtgaaccgtcgtggagaagattccggagtggcttttgccggcatc
ccgctgggacatgaattcacttccttcgtccttgctgtattgcaagtcagtggacgggca
cccaaggtcgacgaggataccctgacgcaaatgaagcatctcgaaggtaccttctcgttt
gaaacgtacgtcagcttaagctgtcagaactgtcccgaagtggttcaggcactgaatatg
ctgagtgctgtaaatccgggtgtatccaataccatgatcgacggcgcggtattcaaacag
gaagtggaagaccgtgatgtcatggctgtccctgctgtttatttgaacggtgaatttttc
ggtggcggacggatgacgatcgaagacattttctcgaaactcggacagggaacagatgcc
aaagccctcaatgaaaaagatccgtttgacgtactcgttgtgggcggtggccctgccgga
gccagtgctgccatctacgcagcccgaaaaggaatccgcaccgggattgttgcagaacgc
ttcggcggccaggttcaggacacattaagcattgagaacttcatcagcaccaaaaagaca
gaaggaccaaagctcgttgcaagccttgaagaacatgtacgggactatgaagtcgatatt
atgaaaagccaaaaggttcaatcccttgaaaaaaaggatcgctttgaactcaccttggaa
aatggcgcaacattaaccagtaaaagtgttattctcgctaccggtgcgcgctggcggaat
gtcggcgttcctggtgaagaggaattcaggaataatggcgttgcttattgcccgcactgc
gacggtcccctgtttgaaggaaaggacacggccgttattggcggcgggaattccggtgtg
gaagcggccattgacctggcagggatcgtgaatcatgtctacctgcttgaattcttgcct
gaactcaaggcggatgaagtactccagaagaaactgcacagcctggacaatgtcactgtc
attacaaatgcaaaaacaaccgaaatcaccggtgataacaaagtaaacggtttatcgtat
caggaccgggtaacggatgaggagaagcatattcctcttgaaggcgtgttcgttcagatc
ggactggttccgaacaccgactggctggatgattcggtcgaaaaaacccgcatgggtgaa
atcgtcgtcaatcagcatggccagtccagtatgcctggcttgttcgcagccggagactgc
accaattccccatataaacagatcatcatttccatggggagcggtgccacggcctcattg
ggcgctttcgattacctgattcgtgcacaggaacccgctctgaccgtttcatcatga

DBGET integrated database retrieval system