KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_178Help
Entry
BGIGA_178         CDS       T02109                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00564  Glycerophospholipid metabolism
bbg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BGIGA_178 (glpA)
Enzymes [BR:bbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BGIGA_178 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Lycopene_cycl FAD_oxidored GIDA HI0933_like Pyr_redox_3 Pyr_redox_2 NAD_binding_8 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFJ90629
UniProt: I3QG94
LinkDB All DBs
Position
complement(194061..195674)
Genome map
AA seq 537 aa AA seqDB search
MMKGFLNRDRFLDILRNVNIWDVIIIGGGATGLGIALDSSSRGYKTLLLEQSDFSKATSS
RSTKLVHGGIRYLAQGNIRLVYEALRERGFLLKNAPHLVKKQKFIIPVFNWRMGIMYWTG
LKLYEWLSGSLSFGKSRFLSKYEIVKIFPEIKSKELKGGILYYDGQFDDSRLAINLAQTC
VQKGGILFNYFQVKSLLKKVENKISGVVACDLETKKEYSIYSKIVINATGVFSDSILRMD
ESACPVFIKPSQGTHIVLDKSFFSSSNAIVIPKTQDGRVLFCVPWYDHVLVGTTDTFLEK
SVLEPKPLEEEIDFILQTFNKYFVLHTKKSDILSAFSGLRPLFIPHNSCSYDPTKTKDIS
RSHKLMISSSGLITIIGGKWTTYRKMAEDTVNKAIEIGKLNKRPSVTKDLKIYGSHSSYS
SYKSKNHYWNKYGEDEYHIKKLIEENPLLGVSLIPQDFYYYTEAEVVWMVRNEMARTIED
VLARRFRLLFLNAKKAIDIAPRVAALMAKELSRDKKWEQSQVADFKKLAMRYYYPVV
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggttttttaaatagagataggtttttggacattttaagaaatgtaaatatt
tgggatgttattattattggaggaggagctacaggattaggaatagctttagattcttct
tccagaggatataaaactcttctattggaacagtctgatttttctaaagcgacttctagt
cgaagtacaaaattagttcatggaggaatccgatatttagctcaaggaaatataagatta
gtttatgaagcattacgagaaagaggttttttactaaaaaatgcacctcatttagttaaa
aaacagaaatttattattccagtattcaattggagaatgggtattatgtactggactgga
ttaaaattgtatgaatggctatctggttctttaagttttggaaaatctaggtttttatct
aaatatgaaatagtcaaaatttttccagaaattaaaagtaaagagttgaaaggaggtatt
ttatattatgatggacagtttgatgattcacgtttagctataaatttagctcaaacttgt
gttcaaaaaggtggaatattattcaactattttcaagttaaaagtttactaaaaaaagtt
gaaaataaaatttctggagttgtagcttgtgatcttgaaactaaaaaagaatattctatt
tattcaaaaatagtaataaacgctactggagttttttctgattctattttaagaatggat
gaatctgcatgtcctgttttcataaaaccgagtcaaggaacacatattgtattagataaa
tctttcttcagtagttcgaatgctatagtaattccaaaaactcaggatggaagagtatta
ttttgtgttccatggtatgatcatgttttagtaggaactacagatacttttttagaaaaa
agtgttcttgaaccaaaacctttagaagaagaaattgattttatattacaaacttttaat
aaatattttgtacttcatacaaaaaaaagtgatatattgagtgctttctctggattgcgt
cctctttttattcctcataattcttgttcttatgatcctactaaaactaaagatatttct
agatctcataaactgatgattagttcttctggactaattactattataggcggaaaatgg
actacatatagaaaaatggcagaagatactgtcaataaagctattgaaataggaaaattg
aataaaagaccttctgttacaaaggatcttaaaatttatggatcccattcttcatattct
tcgtataaaagtaaaaatcattattggaataaatatggagaagatgaatatcatataaaa
aaattaattgaggaaaatccgttgttgggagtttctttgattccacaagatttttattat
tataccgaagcagaagtagtttggatggttcgtaatgaaatggcgagaacaattgaagat
gttttggcgagaaggtttcgtttattatttttaaacgctaaaaaagcaatagatatagca
cccagagtagctgcattaatggctaaagagctttctagagataaaaaatgggaacaatca
caagtagctgattttaaaaaactagctatgcgatactattatccagtagtttaa

DBGET integrated database retrieval system