KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_323Help
Entry
BGIGA_323         CDS       T02109                                 

Gene name
nrdA
Definition
(GenBank) ribonucleoside-diphosphate reductase subunit alpha
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00230  Purine metabolism
bbg00240  Pyrimidine metabolism
bbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BGIGA_323 (nrdA)
   00240 Pyrimidine metabolism
    BGIGA_323 (nrdA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbg03400]
    BGIGA_323 (nrdA)
Enzymes [BR:bbg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     BGIGA_323 (nrdA)
DNA repair and recombination proteins [BR:bbg03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BGIGA_323 (nrdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN MHB
Motif
Other DBs
NCBI-ProteinID: AFJ90768
UniProt: I3QGN3
LinkDB All DBs
Position
351196..352908
Genome map
AA seq 570 aa AA seqDB search
METHPIAEKEGWKVGKDFPVWANNELYLTTIKGGYLLDGETPFEAYNRLAKNAAKILKKP
KIEGEFFNIFWRGWLIPSTPVMVNLGTEKGLPISCFSGRIGDSMYEIYRKNLEMAILSKH
GGGTSYDFSLVRPVGSSIKNGTLGNSDGIIPFIKSYDSAIVASKQGRTRRGAVAIYLNIE
HKEYPEFLKIREPKGDINRQCHNVHQGVIISNSFMEKVLQKNGKERSLWIDTLKERVQTG
EPYLFFKENANKNLPENWKKHGLKIHHSNLCSEIMLPTDESHTLVCCLSSLNLYKYIEWK
NTNTVFYSILFLDAVMQEFIDKGKHIRGIEDSVRFAEKSRALGLGTLGWHSYLQSNMIPF
ISIKSEMLTHNIFRNIQLESQKATKYLAKEYGESEWNIGTGRRNLTLMAMAPNRSSAKLA
GGLSQGVEPLAANIYVDDDSKGMHIRKNPYLENILIKNGYNIPEVWEQIANEKGSCLGLT
ALNEEQKNVFRCFKEINQLELIKQASIRQKYIDQGQSINLSFHQNAPAKYINKVHIEAWK
IGLKSLYYYRSESILRADTRNRDLYSESLL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacaccctattgcagaaaaagaaggatggaaagtaggaaaagattttcccgtt
tgggctaataatgaattatatttaactacaattaaaggtggatacttgttagatggagaa
actccttttgaggcatataatagattagcgaaaaatgctgcaaaaattttaaaaaaacca
aaaatagaaggagagttttttaatattttttggagaggatggctcattccttctactcca
gttatggttaatcttggaacagaaaaaggtttgcctattagttgtttctctggaagaatt
ggggatagtatgtacgaaatatatagaaaaaatttagaaatggcgatactcagtaaacat
ggtggaggcacatcttatgactttagtttagttagacctgtaggaagttctataaaaaat
ggaacattaggaaattctgatggaattatcccttttattaaatcatatgatagtgctata
gtagctagtaaacaaggaagaacacgtagaggtgctgtggctatttatttaaatatagaa
cataaagaatatccagaatttttgaaaattagagaacctaaaggagatattaatcgtcaa
tgtcacaatgttcatcaaggtgtgataatttctaactcttttatggaaaaagtattacaa
aaaaatggaaaagaacgatctttgtggattgatactcttaaagaacgtgttcaaactgga
gaaccatatcttttttttaaagaaaatgccaataaaaatcttccagaaaattggaaaaaa
cacggattaaaaatacatcacagtaatctttgttcagaaattatgttaccaacagatgaa
agtcatactcttgtatgttgtctttcttctttgaacttatataagtatatagaatggaaa
aatacaaacactgttttttattccattttattccttgatgctgttatgcaagaatttatt
gataaaggtaaacatatacgggggatagaagattctgttcgttttgcagaaaaaagtaga
gctttaggtttaggtactttaggctggcactcatatttacaatcgaatatgattcctttt
atatctataaaatcggaaatgttaacacacaatatatttagaaatatacaattagaatct
caaaaagctactaaatatttagctaaagaatatggagaatctgaatggaatattggaaca
ggaagaagaaatctaactttgatggcgatggcacctaataggagttctgctaaattagca
ggcggtctttctcaaggtgtagaacctttagcggcaaatatatatgtggatgatgattca
aaaggaatgcatatccgtaagaatccttatttggaaaatatactcataaaaaatggatat
aatattccagaagtttgggagcaaatagctaatgaaaaaggatcttgtcttggattaaca
gctcttaatgaagaacaaaaaaatgtttttagatgtttcaaagaaattaatcaattagaa
ttaattaaacaagccagcatacgacaaaaatatattgatcaaggacaaagcattaatctt
tcttttcatcaaaatgctccagcaaaatatataaacaaagttcatattgaagcttggaaa
atagggttaaaaagtctttattactatagaagtgaaagtattcttcgagcagataccagg
aatcgagatttatattcggaaagtttgttataa

DBGET integrated database retrieval system