KEGG   Berkelbacteria bacterium GW2011_GWE1_39_12: UT28_C0001G0205Help
Entry
UT28_C0001G0205   CDS       T03992                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit C, aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bbgw  Berkelbacteria bacterium GW2011_GWE1_39_12
Pathway
bbgw00970  Aminoacyl-tRNA biosynthesis
bbgw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbgw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UT28_C0001G0205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bbgw03029]
    UT28_C0001G0205
Enzymes [BR:bbgw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     UT28_C0001G0205
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     UT28_C0001G0205
Mitochondrial biogenesis [BR:bbgw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    UT28_C0001G0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln MCPsignal tRNA-synt_2c
Motif
Other DBs
NCBI-ProteinID: AKM82016
UniProt: A0A0G4B240
LinkDB All DBs
Position
complement(193542..193892)
Genome map
AA seq 116 aa AA seqDB search
MRYDKILIERTKDINKEEDLSLKKEDVEHIAQLSRIEFTDEKKEKFTEEISAILDYVDEL
ETAPTENVETISQISGLKNIARIDEVAESLPNEKVLLNAPEKHDGFIKVRKVFENV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatgataagatattaatcgaaaggacaaaagatattaataaagaggaagatttg
tctttaaaaaaagaagatgttgagcatattgctcaactatcaagaattgaatttactgac
gagaaaaaagaaaaatttaccgaagaaatatcggccattttggattatgtcgatgaacta
gagacagctccgacggaaaatgttgaaacaatttcacaaatttcagggcttaaaaatatt
gccagaatcgacgaagttgcagagagcttaccgaatgaaaaagtattgttaaatgcgccg
gaaaaacacgacggcttcattaaagtaaggaaagtttttgaaaatgtctaa

DBGET integrated database retrieval system