KEGG   Berkelbacteria bacterium GW2011_GWE1_39_12: UT28_C0001G0604Help
Entry
UT28_C0001G0604   CDS       T03992                                 

Definition
(GenBank) ATP-dependent DNA ligase, DNA ligase (ATP)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bbgw  Berkelbacteria bacterium GW2011_GWE1_39_12
Pathway
bbgw03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bbgw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    UT28_C0001G0604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bbgw03400]
    UT28_C0001G0604
Enzymes [BR:bbgw01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     UT28_C0001G0604
DNA repair and recombination proteins [BR:bbgw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     UT28_C0001G0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AKM82405
UniProt: A0A0G4B481
LinkDB All DBs
Position
complement(554961..555887)
Genome map
AA seq 308 aa AA seqDB search
MPKLINQNSEMILTLENKKVKISNPSKIFWPEEKISKLDLINFYTEIAPFILPYLEGRPE
SLFRTPDGIKGLGFFQKDTSNLNLPDWIETKTVSKMENSLTKYLIINDLASLIYVVNLGC
IEINPWASKGPDFEKPDYLILDLDPVESSFDNVIKTALIIKEILDDLNIEGYPKTSGKRG
LHIYLPTGAKYDYAQIKTLAEIIANLAHRKAADFTSLERSPKKRKGKVYLDWLQNGLDKT
TVAPYSVRPAIKATVSVPLDWEEIRSGLNPEDFNLKTVTARLKKKGDLFSSILYSTGFDL
KKVLKKIS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaattaataaatcaaaattctgaaatgatattaacacttgaaaacaaaaaagtt
aaaatttcgaatccatcgaaaatattttggccagaagaaaaaatctctaaattagattta
ataaatttttatacagaaatcgcaccgtttattctaccgtatttagaaggaaggcctgaa
tcactttttcgaacaccagatggaattaaaggattaggtttttttcaaaaagacacttcc
aatttaaatctacccgattggattgaaactaaaacagtcagcaagatggaaaatagttta
actaagtatttaatcattaacgatcttgcctctttaatttatgtggtgaatctgggctgt
attgaaataaatccctgggcttcaaaaggcccagatttcgaaaaacctgactatttaata
cttgatcttgatcctgttgaaagctcttttgataacgtcataaagacggctttaataatt
aaagagattttagacgatcttaatattgagggttacccaaaaacttctggaaaaagaggc
ctacatatctatctgcctacaggcgctaaatacgattacgcacaaataaagacattggca
gagattattgcaaacttagcacatcgcaaggcagcagattttactagtctggaaagaagc
ccaaaaaaaagaaaaggtaaggtatatttagattggttacaaaacggattagacaaaaca
accgttgcaccttattcagttcgtccagccataaaagctactgtatcagtccctcttgat
tgggaggaaataagaagcggcttaaacccggaagattttaatttgaaaacagtaacggct
cgacttaaaaagaagggagatttattttcttcaattttatactcaacaggatttgatctt
aaaaaagttttgaagaaaatttcatga

DBGET integrated database retrieval system