KEGG   Berkelbacteria bacterium GW2011_GWE1_39_12: UT28_C0001G0795Help
Entry
UT28_C0001G0795   CDS       T03992                                 

Definition
(GenBank) superoxide dismutase, superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bbgw  Berkelbacteria bacterium GW2011_GWE1_39_12
Brite
Enzymes [BR:bbgw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     UT28_C0001G0795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKM82575
UniProt: A0A0G4B4N8
LinkDB All DBs
Position
713351..713914
Genome map
AA seq 187 aa AA seqDB search
MYKPKDYGQLLGHGVLSDELLNTHFKLYEGYVNNTNQMLELLDNIDPGTLEYSEIQRRFS
WEWDGMRLHELYFDNLTEEEKDFNINSELGKKINEIYGDFETWRKNFLSVASMRGIGWTI
LYYDESSKELFNVWINEHDGGHFVGCKPILVIDCFEHAYFQDFGSKRPDYLEKIFSHIDW
EKVTERF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaccaaaagattatggacaactgctggggcatggagttttaagcgatgaatta
ttaaatactcattttaaattgtatgaaggttatgtaaataacacgaatcaaatgttagaa
cttctggataatatagatcctgggacacttgaatactcggaaattcagcgaagattttca
tgggaatgggacggaatgagattgcatgagctttatttcgataatttaactgaggaagaa
aaagactttaacattaactctgaattaggcaaaaaaatcaatgagatttacggtgacttt
gaaacttggagaaagaattttctttcagttgcctcaatgcgggggattggatggacgatt
ttatattatgacgaatcttcaaaagagcttttcaatgtttggataaatgaacatgatggc
ggacattttgttggctgtaaacctatcctagttattgattgttttgagcacgcttacttt
caagattttgggtctaaaagacccgactatttagaaaaaatcttttcacatattgattgg
gaaaaagtaactgaaagattttag

DBGET integrated database retrieval system