KEGG   Bordetella bronchiseptica 253: BN112_0559Help
Entry
BN112_0559        CDS       T02344                                 

Gene name
gst
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN112_0559 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bbh02000]
    BN112_0559 (gst)
Enzymes [BR:bbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN112_0559 (gst)
Transporters [BR:bbh02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN112_0559 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-GeneID: 13977617
NCBI-ProteinID: YP_006966642
UniProt: A0A0C6P1I1
LinkDB All DBs
Position
complement(576429..577052)
Genome map
AA seq 207 aa AA seqDB search
MSRWTFYTAPGTCALATHIALHEAGADFDLVKLDFGATQQQSPDYLRVNPKGRVPALATE
HGVLTENPALLAFIAQSFPQAQLAPLGDPFAFARMQELANYLASTAHVAHAHKRRGARWA
DDPAAHEAMRAKIPENMTAIAGYLESQIVGPWALGERFSVVDGYLYTVGSWMEGDSVDMT
RFPKLADYLARVGARPAVQRALAEMNG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctggaccttctataccgcccctggcacctgtgcgctggcgacgcacatcgcg
ctgcacgaagccggcgccgatttcgatctggtcaagctggatttcggcgccacgcagcag
caaagccccgactacctgcgcgtcaaccccaagggccgcgtgccggcgctggccaccgaa
catggcgtgctgaccgagaatcccgccctgctcgctttcatcgcgcagagctttccgcag
gcgcagctggcgccgctgggcgatccgttcgcgttcgcgcgcatgcaggaactggccaac
tacctggcctccaccgcgcacgtcgcgcacgcgcacaaacggcgcggcgcgcgctgggcc
gacgacccggccgcgcacgaggccatgcgcgccaagatccccgagaacatgacggccatc
gccggctacctggaatcgcagatcgtcggtccctgggcactgggcgagcgcttcagcgtg
gtcgacggctatctgtacaccgtcggcagctggatggaaggcgacagcgtcgacatgacg
cgctttcccaagctggccgactacctggcgcgcgtcggcgcgcggccggccgtgcagcgc
gcgctggccgagatgaacggctga

DBGET integrated database retrieval system