KEGG   Bordetella bronchiseptica 253: BN112_0862Help
Entry
BN112_0862        CDS       T02344                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00564  Glycerophospholipid metabolism
bbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN112_0862
Enzymes [BR:bbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN112_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like Pyr_redox_2 GIDA FAD_binding_3 NAD_binding_8 Pyr_redox Pyr_redox_3 Thi4
Motif
Other DBs
NCBI-GeneID: 13977920
NCBI-ProteinID: YP_006966943
UniProt: A0A0C6P0G8
LinkDB All DBs
Position
920268..921872
Genome map
AA seq 534 aa AA seqDB search
MTAPTLAPIDPPARAQLLADLQGAPDWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADF
AKGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYSLLDQ
PFYGVGLKMYDMLAGKLNLAPSRWLSRGETLRHAATVAERVNGRALRGGILYYDGQFDDA
RLAIALMRTLYDLGGVALNYARAVGLTRTDGRVDGVTVADALGELRVTLRAKCVVNATGV
WVDAVRRMDDPAAQTMVAPSQGVHLTLPRDFLPGEDAILIPKTDDGRVLFVVPWNGHTIV
GTTDTPRTDLPLDPQAGQNEIDFILATAARYLSRKPTRADVTSVWAGLRPLVKATGEAST
KSLSREHTIVVSKGGLVTVTGGKWTTYRKMAQDVVDTAIQHKLLAAAPCRTAELPLHGAP
TDGQPNGAPHGTPDSYYGTDLATLRALPGADRMLVKASALTEAHVRYAARHELARTVEDV
LARRNRALFLDAEAALLAAPEVARILAQELGHDEAWSRATLAEFEAVAAHYRLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctaccctcgctcccatcgacccgcccgcgcgcgcgcaactgcttgccgac
ctgcaaggcgcccccgattgggatgtcatcgtcatcggcggcggcgccaccggcctgggc
accgccgtcgatgccgccgcgcgcggctaccgcaccctgctggtggaggccgccgacttc
gccaagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcg
cagggcaatatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaac
gcgccgcacctggtgtggccgctgggcttcgtcgtgccggcctacagcctgctggaccag
ccgttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcg
cccagccgctggctgtcgcgcggcgaaacgctgcgccacgccgccaccgtggccgagcgc
gtcaacggccgcgccttgcgcggcggcatcctgtactacgacggccagttcgacgatgcg
cgcctggccatcgccctgatgcgcaccttgtacgacctgggcggcgtggcgctgaactac
gcgcgcgcggtcggcctgacgcgcacggacggccgcgtcgacggcgtgacggtggccgac
gcgctgggcgagctgcgcgtgacgctgcgcgccaaatgcgtggtcaacgccaccggcgtg
tgggtcgacgcggtgcgccgcatggacgaccccgccgcgcagaccatggtggcgcccagc
cagggcgtgcacctgacgctgccgcgcgacttcctgcccggcgaagacgccattctcata
cccaagaccgacgacggccgggtgctgttcgtggtgccctggaacggccacaccatcgtc
ggcaccaccgacacgccgcgcaccgacctgccgctcgatccgcaggccggccagaacgaa
atcgacttcatccttgccaccgcggcgcgctacctgagccgcaagcccacccgcgccgac
gtgaccagcgtgtgggccggcctgcgcccgctggtcaaggccaccggcgaagcctcgacc
aagtcgctgtcgcgcgaacacaccatcgtggtctccaagggcgggctggtcacggtcacc
ggcggcaaatggaccacctaccgcaagatggcccaggatgtggtcgacaccgccatccag
cacaagctgctggccgcggcgccctgccgcacggccgagctgccgctgcatggcgcgccg
accgacgggcagcccaacggcgcgccccacggcacgcccgacagctactacggcaccgac
ctggcgacgctgcgcgcgctgcctggcgccgaccgcatgctagtcaaggccagcgccctg
accgaggcgcacgtgcgctatgccgcccgccacgaactcgcgcgcaccgtggaggacgtg
ctggcccgccgcaatcgcgccctgttcctggacgccgaggccgccctgctggccgcgccc
gaagtggcccgcatcctggcgcaggaactcggccacgacgaagcctggagccgcgccacg
ctggccgagttcgaggccgtggccgcgcactaccggctggcctga

DBGET integrated database retrieval system