KEGG   Bordetella bronchiseptica 253: BN112_1073Help
Entry
BN112_1073        CDS       T02344                                 

Gene name
dadX
Definition
(RefSeq) alanine racemase, catabolic
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00473  D-Alanine metabolism
bbh01100  Metabolic pathways
bbh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BN112_1073 (dadX)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BN112_1073 (dadX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bbh01011]
    BN112_1073 (dadX)
Enzymes [BR:bbh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BN112_1073 (dadX)
Peptidoglycan biosynthesis and degradation proteins [BR:bbh01011]
 Precursor biosynthesis
  Racemase
   BN112_1073 (dadX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 13978131
NCBI-ProteinID: YP_006967152
UniProt: A0A0C6P0E9
LinkDB All DBs
Position
complement(1155061..1156188)
Genome map
AA seq 375 aa AA seqDB search
MPRPIFASISQSALRHNLATVRRHLDDVAAKADGTPPSIWAVIKANAYGHGIEQAVAGFS
AAQGLAMLDLQEAVRCREAGWGGPILLLEGFFQPSDLEIVDRYHLATTVHTREQFDMLAH
ARLSRRVDIMVKLNSGMNRLGFAPDAYGSAYARAQQLHEYGVVGGIGKMTHFACADGPQG
VTQQMNVFNGATAHLAGATSVCNSAATLRYADLAVGHDGQTHWVRPGICLYGASPFADAQ
AGAFGLIPAMTLRSELIAIQDIPAGAAVGYGAIFRADRPMRIGVVACGYADGYPRHAGTG
TPLTVGGVRTRLVGRVSMDMLMVDLDPVPAAGIGTPVVLWGEDGPSVDEVAEAAGTIGYE
LLCALAPRVPVRHEG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcccatatttgcttcgatctcccagtccgcgctgcggcacaaccttgccacc
gtgcgtcgtcatctcgatgacgtggcggccaaggcggacggcacgccgccctccatctgg
gcggtcatcaaggccaatgcctacggccatggcatcgaacaggcggtggccggtttctcg
gcggcccagggcctggccatgctggacctgcaggaggccgtgcgctgccgcgaagcgggc
tggggcggccccatcctgctgctcgaaggcttcttccagccgtccgacctggaaatcgtc
gaccgctatcatctcgccaccaccgtgcatacgcgcgagcagttcgacatgctggcgcat
gcgcggctgtcgcgccgcgtcgacatcatggtcaagctcaacagcggcatgaaccggctg
ggtttcgcgccggacgcctacgggtccgcctacgcgcgcgcgcagcagctgcatgagtac
ggcgtagtgggcggcatcggcaagatgacccatttcgcctgtgccgacgggccgcagggc
gtgacccagcagatgaacgtcttcaacggcgccaccgcgcacctggccggggcgaccagc
gtctgcaattcggccgccaccctgcgctatgccgacctggcggtcggccacgacggccag
acccactgggtgcggccgggcatctgcctgtacggcgcctcgccgttcgccgatgcgcag
gccggggcgttcggattgattccggccatgacgctgcgctccgagctgattgccatccag
gatatcccggccggcgcggcggtgggttatggcgccattttccgcgccgaccggccgatg
cgcatcggcgtggtggcgtgcggctatgccgacggctatccgcgccatgccggcaccggt
acgcccctgaccgtgggcggcgtgcgcacgcggctggtcggccgcgtgtcgatggacatg
ctcatggtcgacctggatccggtgccggccgccggcatcggcacgcccgtggtgctgtgg
ggcgaggacggcccgtcggtcgacgaagtggccgaggccgccggcaccatcggctacgaa
ttgctgtgcgcgctggccccgcgcgtacccgtgcgccacgaaggctga

DBGET integrated database retrieval system