KEGG   Bordetella bronchiseptica 253: BN112_1635Help
Entry
BN112_1635        CDS       T02344                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00250  Alanine, aspartate and glutamate metabolism
bbh00280  Valine, leucine and isoleucine degradation
bbh00410  beta-Alanine metabolism
bbh00640  Propanoate metabolism
bbh00650  Butanoate metabolism
bbh01100  Metabolic pathways
bbh01120  Microbial metabolism in diverse environments
Module
bbh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN112_1635
   00650 Butanoate metabolism
    BN112_1635
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN112_1635
   00280 Valine, leucine and isoleucine degradation
    BN112_1635
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN112_1635
Enzymes [BR:bbh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BN112_1635
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BN112_1635
Amino acid related enzymes [BR:bbh01007]
 Aminotransferase (transaminase)
  Class III
   BN112_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 13978693
NCBI-ProteinID: YP_006967703
UniProt: A0A0C6P5V8
LinkDB All DBs
Position
1760151..1761425
Genome map
AA seq 424 aa AA seqDB search
MDNAELTRRKEAATPRGVGVMCNFYADRAENAELWDTEGRRYIDFAGGIAVLNTGHRHPQ
LMQALQAQMSRFTHTAYQIVPYASYIQLAERINQLAPGDFAKKTALFTTGAEAVENAVKI
ARAATGRPAVVAFGAAFHGRTLLGMALTGKVVPYKVGFGPFPADIYHVPYPNALHGVSTD
DALAALGTLFKTDVDPRRVAAIIIEPVQGEGGFNICPPAFMQALRALCDDHGILLIADEV
QTGFGRTGKLFAMEHYGVAADLTAMAKSLAGGMPLSAVCGRAEVMDAPPPGGLGGTYAGN
PLAVAAALEVIRIIEAEDLLARGTRLGHQLRDHLEAQRHDVPEIAEVRALGAMVAVEFRQ
PGSDAPSPEFARQVQARALEQGLLLLTCGSDGNVIRFLFPLTIPEAVMREALDILARTLR
GQNA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcagaactgacccgccgcaaggaggccgccacgccgcgcggcgtgggcgtg
atgtgcaacttctacgcggaccgcgccgagaacgccgaactgtgggataccgaaggccgc
cgctacatcgacttcgccggcggcatcgccgtgctcaacaccggccatcgccatccgcag
ctgatgcaggcgctgcaggcgcagatgagccgcttcacccacacggcctaccagatcgtc
ccgtacgccagctatatccagctggccgaacggatcaaccagctggcgccgggcgatttc
gccaagaagaccgccctcttcaccacgggagccgaggcggtcgagaacgccgtcaagatc
gcccgcgcggccaccggccggcccgccgtcgtcgccttcggcgcggcgttccacggccgc
acgctgctgggcatggccctgaccggcaaggtcgtgccgtacaaagtgggcttcggtccg
tttccggccgacatctaccatgtgccgtatccgaacgcgctgcacggggtatccaccgat
gacgcgctggcggccctggggaccctgttcaagaccgacgtggacccgcgccgcgtggcg
gccatcatcatcgaaccggtacagggcgagggcggtttcaatatctgcccgccggccttc
atgcaggcgctgcgcgccctgtgcgacgaccacggcatcctgctgatcgccgacgaagtc
cagaccggcttcggccgcaccggcaagctgttcgcgatggaacactacggcgtggcggcc
gacctgaccgccatggccaagagcctggccggcggcatgccgctgtcggcggtgtgcggc
cgcgccgaggtcatggacgcgccgccgccgggcggcctgggcggcacctatgccggcaat
ccgctggcggtggccgccgcgctggaggtgatccgcatcatcgaggccgaggacctgctg
gcgcgcggcacgcgcctgggccaccagttgcgcgaccacctggaggcgcagcgccacgac
gtccccgagatcgccgaggtgcgggcgctgggcgccatggtggcggtggaattccgccag
cccggcagcgatgcgcccagccccgaattcgcgcgccaggtccaggcccgcgcgctcgaa
caggggttgctgctcctgacctgcggcagcgacggcaacgtcatccgctttcttttcccg
ctgacgatcccggaggcggtcatgcgcgaagcgctggacatcctggcccggacgttgcgc
ggccagaacgcttga

DBGET integrated database retrieval system