KEGG   Bifidobacterium bifidum S17: BBIF_1734Help
Entry
BBIF_1734         CDS       T01328                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
bbi  Bifidobacterium bifidum S17
Pathway
bbi00511  Other glycan degradation
bbi00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bbi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BBIF_1734
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BBIF_1734
Enzymes [BR:bbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     BBIF_1734
Bacterial toxins [BR:bbi02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   BBIF_1734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR NPCBM_assoc Trypan_PARP FixG_C
Motif
Other DBs
NCBI-ProteinID: ADO53939
UniProt: E3ERD5
LinkDB All DBs
Position
complement(2102857..2105367)
Genome map
AA seq 836 aa AA seqDB search
MVRSTKPSLLRRLGALVAAAAMLVVLPAGVSTASAASDDADMLTVTMTRTDTLGDEVYVG
DTLTYSFTNTNNTSSAFTAFPAESNLSGVLTTGTPNCRYENLAGGASYPCSTASHTITAD
DLTAGSFTPRTVWKATSDRGGTQVLQDNIVSTGDTVTVKEGKRPDPATIPTDRADGEAVR
LATARQNLGTECYRIPALAEAPNGWILAAFDQRPNTAMANGSGVKCWDAPQPNSIVQRIS
KDGGKSWTPIQYVAQGKNAPERYGYSDPSYVVDEETGEIFLFFVHSYNKGFADSQLGVDE
SNRNVLHAVVVSSKDNGETWSKPRDITADITKGYENEWKSRFATSGAGIQLKYGKYKGRL
IQQYAVGRTTGSNAAVSVYSDDHGKTWQAGNPVTGMLMDENKVVELSDGHVMLNSRPGNG
SGYRRVAISEDGGVNYGTVKNETQLPDPNNNAHITRAFPNAPEGSAKAKVLLYSSPRANN
EGRANGVVRISLDDGTTWSSGKLYKAGSMAYSVITALSGAAGGGYGLLYEGAWVTGGGID
SHDIMYTHISMDWLGYLSATADDVTASVEEGASTVDVTVPVSNVGSVDYTGVTVTPADLP
TGWSASPVNVGALASGASKDVTVTVNVPATAKKDDVAKIVLRVTGTSAANADATTGFDGS
ITVNVTEKSEPDPEPEPTITGVSAVTSQAGVKVGDVFDASKVSVTAAMSDGSSKALAAGE
YSLSAVDADGKAVDLAEPFAAAGVVTVTVSVPVEGADPLTASFTIDVAEKSADPEPKPEP
EPKPEPEKPAGPKVDVPTEKPGLSKTGASTAGMSIVFVLLALSGVAALSLRRRSVH
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggttcgttcgaccaagccatcgctgctgcgccgtcttggcgcgctggtggcggccgct
gccatgctggtggtactgcccgcaggggtatccaccgcgagtgcggccagcgatgatgct
gacatgctcaccgtcacgatgacgcgtaccgacaccctcggcgacgaggtatatgtcggt
gacacgctcacctacagtttcaccaacaccaacaacacgagttcggcattcaccgcattc
cccgccgagtcgaatctgagcggtgtgctgaccacaggaacgccgaactgccgttatgag
aaccttgcgggaggcgcttcctacccttgctccacggccagccacaccatcactgcggat
gatctcacggccggcagcttcaccccgcgtaccgtgtggaaggccacctctgaccgaggg
ggcactcaggtgctgcaagacaacatcgtctccaccggcgataccgtcaccgtgaaggaa
ggcaagcgccccgatccggccaccatccccacagaccgtgccgatggcgaggccgtgcgc
ctggccaccgcccgccagaacctcggtaccgaatgctaccgtattccggcgctcgccgag
gcgcccaacggctggatcctcgccgcattcgaccagcgtcccaatacggcgatggccaac
ggcagcggcgtcaagtgctgggatgccccgcagccgaactccatcgtgcagcgcatctcc
aaggatggcggcaagtcgtggacgccgatccaatatgtcgcgcagggcaagaacgccccg
gaacgctacggctattccgacccatcctatgtggtcgatgaggagaccggcgagatcttc
ctgttcttcgttcactcgtacaacaagggcttcgccgactctcagcttggcgtcgatgag
agcaaccgcaatgtgctgcatgcggtcgtcgtcagctcaaaggacaacggcgagacgtgg
agcaagccgcgtgacatcaccgctgacatcaccaagggttacgagaacgagtggaagtcc
cgtttcgccacctccggtgccggcatccagctcaagtacggcaagtacaagggtcgtctg
attcagcagtatgccgtgggccgtacgaccggttcgaacgccgcggtatccgtgtactcc
gacgaccatggcaagacctggcaggccggcaacccggtgacgggcatgctgatggatgag
aacaaggtcgtggagctgtctgatggccatgtgatgctcaactcccgcccgggtaacggt
tccggttaccgtcgcgtggcgatttcggaggacggcggcgtgaactacggtacggtcaaa
aacgagacgcagctgccggatccgaacaacaacgcgcatattacgcgcgcgttcccgaat
gctcccgagggctcggcgaaggcgaaggtgctgctgtactcgtcgccgcgcgcgaacaac
gagggccgtgcgaacggcgtggtccgcatctcgctcgatgacggtaccacgtggtcatcc
ggaaagctgtacaaggcaggctcgatggcctactcggtcatcaccgcgctgagcggtgcc
gctggcggtggttatggtctgctgtacgaaggcgcttgggtcaccggcggcggcattgac
agccacgacatcatgtacacgcacatttccatggattggctcggctacctgtccgccacc
gcagacgacgtgaccgcttcggttgaagagggtgccagcacggtggacgtgactgttccg
gtgagcaacgtcggttctgtggattacaccggcgtgacggtgactccggccgatctgccg
accggctggtctgcctctccggtgaacgtgggcgctcttgccagcggcgcgtccaaggac
gtgaccgtcacggtgaatgttcccgcaactgccaagaaggacgatgtcgccaagatcgtc
ctgcgtgtgaccggcacgtccgctgcgaatgccgacgccacgaccggctttgacggctcc
atcacggtgaacgtcaccgaaaagagcgagcccgatcctgagccggagccgaccatcacc
ggtgtttcggcggtgacgtcgcaggctggtgtgaaggtcggtgacgtgtttgatgcgtcg
aaggtgtcggtgaccgcggcgatgagtgatggttcgtcgaaggcgttggctgccggcgag
tattcgctgtcggctgtggatgctgacggcaaggcggtcgatttggctgagccgttcgcg
gcggctggtgtggtgacggtcacggtgagtgtgcctgtggagggtgcggatccgttgact
gcctcgttcaccatcgacgtggccgagaagagcgccgatcctgagcccaagcccgaaccc
gaacccaagcccgaaccggagaagccggccggaccgaaggtcgacgtgcccaccgagaag
cccggcctgtccaagaccggcgcttccacggcaggcatgtccatcgtgttcgtcttgttg
gcactgtccggtgtcgcggcgttgtcgctgcgccgccgctccgttcactga

DBGET integrated database retrieval system