KEGG   Bartonella bacilliformis: BARBAKC583_0840Help
Entry
BARBAKC583_0840   CDS       T00456                                 

Definition
(GenBank) dihydroorotase family protein
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00240  Pyrimidine metabolism
bbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BARBAKC583_0840
Enzymes [BR:bbk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     BARBAKC583_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 DHOase
Motif
Other DBs
NCBI-ProteinID: ABM45630
UniProt: A1UT25
LinkDB All DBs
Position
858315..859610
Genome map
AA seq 431 aa AA seqDB search
MTRPIVFQNARIVDPSRAIDEIGTVIIENGLITVAGKESLNQGTPESAEIIDASNKAILP
GLVDSRVFIGEPGAEHRETIASASQAAAAGGITSFLMMPDTQPVIDNVALVKFITRTAQE
MSLVNIYPVAAITQGLNGQKIAEFGLLKNAGVIAFSEGKKTLQNSSIMRRAMTYARDFDV
ALIHETQDKDLTGQGVMNEGLLASWLGLSGVPREAEVIPLERDLRLAALTKVNYHAAQIS
TAMSADAIRLAKQHNTKISAGVSINHLSLNENDIGEYRTFFRLIPPLRSEEDRIAMIEAI
NDGTIDVIVSSHDPQDVDTKRLPFQDAAAGAIGMETLLSAALRLYHNKSVSLLRLIELLS
TAPAKLFGLNAGTLMKGAPADLILVDLDEPWVLSPDILHSRSKNTPFENTRFQGRVIQTF
VKGKSVFNLNH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggccaatagtttttcaaaatgcccgtattgttgatccttcacgcgcgatcgat
gaaattggcacagtcattattgaaaatggactcattacggttgctggaaaagaatccctc
aaccagggaacacctgaaagcgcagaaatcattgatgcaagcaataaagcaattttacct
ggacttgttgattcccgagtttttattggtgaaccaggagctgaacatcgtgaaacaatt
gcttcggcaagccaagcagcagcagcaggaggaattacctcttttttgatgatgccggac
acacaaccggtcattgataatgtagctcttgtcaaatttattacacggacagcacaagaa
atgtcattggtcaatatttaccctgtggcagctatcactcaagggttaaatggacaaaaa
atagctgaatttggcttattaaaaaatgcaggtgtaattgccttcagcgaggggaaaaaa
actcttcagaattcatctattatgcgtcgtgcaatgacttatgctcgcgactttgatgtc
gctttaattcatgaaacgcaagacaaagacctaactggccaaggtgttatgaatgaaggc
ttattagcgagttggcttggtctttctggagtgcctcgtgaagcagaagtcatcccttta
gaaagagatttgcgactggctgcattaacaaaagtaaactatcatgctgctcaaatatca
acagctatgtctgctgatgctattcgtttagcaaaacaacataatacaaaaatttcagcg
ggtgtatcaattaatcatttatctcttaatgaaaatgatattggtgaatatcgtaccttt
tttcgtttaatacctccattgcgttcagaagaagatcgtattgcaatgattgaagcaata
aacgatggaacaatagatgttattgtttcttcacatgatcctcaagatgttgatacaaag
cgtttaccctttcaagacgctgcagcaggcgctattggaatggaaactttattaagtgcg
gctttacgtttgtatcacaataaatccgtatctcttttacgtttaatcgaactcttatca
acagcacctgcaaaactttttggtttaaatgctggaacacttatgaaaggtgctcctgca
gatcttattttggttgatcttgatgaaccatgggtattatctccagatatattgcactca
cgctcaaaaaatacaccctttgaaaatacacgctttcaaggacgtgtaattcaaaccttt
gttaagggtaaatcagtgtttaatcttaaccactaa

DBGET integrated database retrieval system