KEGG   Bartonella bacilliformis: BARBAKC583_1093Help
Entry
BARBAKC583_1093   CDS       T00456                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bbk  Bartonella bacilliformis
Pathway
bbk00473  D-Alanine metabolism
bbk01100  Metabolic pathways
bbk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bbk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BARBAKC583_1093 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BARBAKC583_1093 (alr)
Enzymes [BR:bbk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BARBAKC583_1093 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:bbk01011]
 Precursor biosynthesis
  Racemase
   BARBAKC583_1093 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Indigoidine_A
Motif
Other DBs
NCBI-ProteinID: ABM45232
UniProt: A1UTQ2
LinkDB All DBs
Position
1123120..1124241
Genome map
AA seq 373 aa AA seqDB search
MNQLVDYKTNAELPYTTVATIDLGAIIANYKILAQHIAPAECSAVVKANAYGMGAEKISS
ALYQAGCRTFFVSQIQEALQLKTILPSNITLVLLNGFPPTTEEFVAQAGLIPVLNSWHAI
ESWQMLCQKKHQKFPAIIQIDTHMNRLGLDQEELQQLIKQPTIFEKANIKYIMSHLSNGD
DATHASNDTQLTAMKTALAQLPTCKVSLANSGGIFLNSDFYFDLVRPGIALYGVDPHGKC
PTPIKPVLKLETQVIQSRHVDAGTPVGYGGSFVTSRPSTLTTISIGYADGWLRTLSNKGV
VYFNGHKLPIIGRISMDSTIVDATDLECEKPKIGDWVELIGPHQTVEDVAADADTIPYEI
LTSLGPRCKRIYI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaactcgttgattataaaacaaacgctgaacttccttatacaactgtagcgacc
attgatcttggtgctattattgcaaattataaaattttagcccaacatattgctcctgca
gaatgctccgctgttgtgaaagcaaatgcctatggaatgggagctgaaaaaatttcttct
gcactttatcaggctggttgccgtaccttttttgtttctcaaatccaagaagcactgcag
ctaaaaaccattttaccttccaatattaccctcgtccttcttaacggctttccaccgacg
acagaggaatttgtcgctcaagcgggtcttatccctgttctgaattcttggcatgcgatc
gaaagttggcaaatgctttgccaaaaaaaacatcaaaaatttccagcaatcatccaaatt
gatacgcatatgaaccgattggggcttgatcaagaagagttacaacagcttattaaacaa
cctaccatttttgaaaaagccaacataaaatatattatgagccatctttccaatggagat
gacgctacacatgcatcaaatgatactcaattaactgcgatgaaaacagcgctcgcacag
ctccccacctgtaaagtctcacttgccaattctgggggaattttccttaattcagacttt
tactttgatctcgttcgtccaggcattgcactttacggggttgaccctcatggaaaatgt
ccaacccctatcaaacctgttttaaaactcgaaacccaggttattcagagccgccatgtt
gatgcaggcacccctgttggctatggaggaagtttcgtgacctctcgaccgagcaccctc
acaactatttctatcggctatgctgatggttggctgcgcactctttctaataaaggtgtc
gtttatttcaacggacataaactccctattattggacgtatctctatggattccacaatt
gtggatgcaaccgatcttgagtgtgaaaaacctaaaataggcgactgggtagagctgatt
ggcccccatcaaactgttgaagatgttgctgcagatgcagataccattccgtatgaaatt
ttgacatctcttggccctcgctgtaaacgaatttacatttaa

DBGET integrated database retrieval system