KEGG   Blattabacterium sp. (Blattella germanica) Bge: BLBBGE_458Help
Entry
BLBBGE_458        CDS       T00995                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bbl  Blattabacterium sp. (Blattella germanica) Bge
Pathway
bbl00564  Glycerophospholipid metabolism
bbl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLBBGE_458 (glpD)
Enzymes [BR:bbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BLBBGE_458 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 GIDA HI0933_like Lycopene_cycl NAD_binding_8 Pyr_redox_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ACY40465
UniProt: D0JBC7
LinkDB All DBs
Position
456166..457767
Genome map
AA seq 533 aa AA seqDB search
MKGFLNRDKFLNILENVNIWDIIIIGGGATGLGIALDSSSRGYKTLLLEQSDFSKGTSSR
STKLVHGGIRYLAQGNIKLVYEALQERGFLLKNAPHLVKKQKFIIPIFSWKMGFFYWTGL
KLYEWLSGSLSFGKSKFLSKNEVIRNFPEIQTNKLKGGILYYDGQFDDARLAINLAQTCV
QQGGVLLNYFQVKSLIKKVGDRISGVVASDLETEKKYSIYSKIVINATGVFSDSISKMDE
SECPILIKPSQGTHIVLNKSFFSSSNAVVVPKTSDGRILFCVPWYDHVLVGTTDTFLEKS
VLEPKPLEEEIEFILQTFNKYFVFNPKKSDILSAFSGLRPLFVPNDSSSTIKTKDISRSH
KLIISSSGLISIIGGKWTTYRKMSEEAVNKAVEIGKLKKKPSVTKNLRIYGSNSSSKSQN
DHWKKYGEDEYHIKKLIEENPLLGTPLISQDTYSYYCTEAEVIWMVRYEMARTIEDVLAR
RFRLLFLNAKKAIDIAPRVAALMAKELSRDEKWEKSQIADFKKLAMRYYYPVV
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttttttaaatagagataagtttttgaacatcttagaaaatgtaaatatttgg
gatattatcattattggaggaggagctactggattgggaattgctttagattcgtcttct
agaggatataaaactcttcttttggaacagtcagatttttctaaaggaacttccagtcgt
agtaccaaactcgttcacggaggaatacgatatttggctcaaggaaatataaaattagtt
tatgaagctttacaagaaagaggttttttgttaaaaaatgctcctcatttagtgaaaaaa
caaaaatttattattccaatttttagttggaaaatgggttttttttactggactggttta
aaattgtatgaatggttatctgggtccttgagttttggaaaatccaaatttttatccaaa
aatgaagtaattagaaattttcctgaaattcaaactaataagttaaaaggaggtatttta
tattatgacggtcagtttgatgatgctcgtttggctattaatttggctcaaacttgtgtt
cagcaaggtggagttttgttaaactattttcaagtcaaaagtcttatcaaaaaagttgga
gataggatatctggagttgtagcttctgacctagaaacagaaaaaaaatattctatttat
tcaaaaattgttataaatgccactggagttttttctgattccatttcaaaaatggatgaa
tctgaatgccccattttaataaaacctagccaaggaacacatattgtgttaaataaatcc
ttttttagcagttcgaatgctgtagttgttccaaaaacttcggatgggagaatcttattt
tgtgttccatggtatgatcatgttttggtaggaactacagatacttttctagaaaaaagt
gttctggaaccaaaacctttagaggaagaaatagagtttattttacaaacttttaacaag
tattttgttttcaatccaaaaaaaagtgatatactcagtgctttttctggattgcgtcct
ctttttgtacctaatgattcttcttctactattaaaacaaaagatatttctagatctcat
aaacttattattagttcttctggattaataagcattataggcggaaaatggacaacatat
agaaaaatgtccgaagaagctgtgaataaagccgttgaaataggaaaattaaagaaaaag
ccttctgttacaaaaaaccttagaatttatgggtcgaattcttcatccaaaagccaaaat
gatcattggaaaaaatatggagaagatgaatatcatattaaaaaattaattgaggaaaat
ccattattaggaactcccttgatatcccaagatacttattcttattattgtactgaagca
gaagttatatggatggttcgttatgaaatggctcgaacaattgaagatgttttggcaaga
aggtttcgtttattgtttttgaatgcaaaaaaagcaatagatatagcaccaagagtagca
gcattaatggctaaagagctttctagagatgagaaatgggaaaaatcacaaatagctgat
tttaaaaagttagctatgcggtactattatccggtcgtttga

DBGET integrated database retrieval system