KEGG   Bordetella bronchiseptica MO149: BN115_0718Help
Entry
BN115_0718        CDS       T02295                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00010  Glycolysis / Gluconeogenesis
bbm00053  Ascorbate and aldarate metabolism
bbm00071  Fatty acid degradation
bbm00280  Valine, leucine and isoleucine degradation
bbm00310  Lysine degradation
bbm00330  Arginine and proline metabolism
bbm00340  Histidine metabolism
bbm00380  Tryptophan metabolism
bbm00410  beta-Alanine metabolism
bbm00561  Glycerolipid metabolism
bbm00620  Pyruvate metabolism
bbm00625  Chloroalkane and chloroalkene degradation
bbm00903  Limonene and pinene degradation
bbm01100  Metabolic pathways
bbm01110  Biosynthesis of secondary metabolites
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN115_0718
   00053 Ascorbate and aldarate metabolism
    BN115_0718
   00620 Pyruvate metabolism
    BN115_0718
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BN115_0718
   00561 Glycerolipid metabolism
    BN115_0718
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN115_0718
   00310 Lysine degradation
    BN115_0718
   00330 Arginine and proline metabolism
    BN115_0718
   00340 Histidine metabolism
    BN115_0718
   00380 Tryptophan metabolism
    BN115_0718
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN115_0718
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN115_0718
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BN115_0718
Enzymes [BR:bbm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BN115_0718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: CCJ57474
LinkDB All DBs
Position
763582..765003
Genome map
AA seq 473 aa AA seqDB search
MMDYAEFYADGAFHPCGGAAVLPVYNPATEQAEAAVRACSADDLERAVRAAAAAGPGWAA
APLAQRRDALDRLAEALRQRAPDIVAGLAREIGCPVWLGELMQVPMAMKGMAHARDGMDA
IAWRERIGNGLVERVPVGVIAAITPWNFPLHQIVAKVAAALAAGCTVVLKPSELAPGAAW
QFIQACHDAALPPGVVNLVWGDAAIGQALVAHEAVDQVSFTGSTEVGRSIMAEAGRHLKR
TTLELGGKSAAVLLPDAELERALPVVLRMAVANSGQACVSQSRLIVPRQRLAEAEQALAA
LAQAWPQGDPLDAATRLGPLANARQFERVNALVSRALQQGARLVAGGPGRPAGQARGWHV
PVTILSDVTPDMELAQEEVFGPVLALMPYDDEARALALANSTRYGLSGAVWSADAARAAA
FARRMKTGQVIINGADQNLATPFGGRGASGVGRENGRFGIEECLTWQALHGAP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgatggattacgccgagttctatgccgacggggcattccatccatgcggcggcgccgcc
gtcctgccggtgtacaaccccgccaccgagcaggccgaggcggcggtgcgcgcctgctcg
gcggacgacctggagcgggccgtgcgcgccgcggccgcggccggcccgggctgggccgcc
gcgccgctggcgcagcgccgcgacgcgctggaccggttggccgaggccttgcggcagcgc
gccccggacatcgtggcgggcctggcgcgcgagatcggctgcccggtctggctgggcgag
ctgatgcaggtgcccatggcgatgaaaggcatggcgcacgcgcgcgacggcatggacgcc
atcgcctggcgcgagcgcatcggcaacggcctggtcgaacgcgtgccggtgggcgtgatc
gcggccatcacgccctggaacttccccctgcaccagatcgtcgccaaggtggcggcggcc
ctggccgccggctgcaccgtggtgctcaagcccagcgagctggcccccggcgcggcctgg
caattcatccaggcctgccacgacgcggccttgccgcccggcgtggtcaacctggtctgg
ggcgacgcggccatcggccaggcgctggtcgcgcatgaggcggtggaccaggtcagcttc
accggcagcaccgaggtggggcgcagcatcatggccgaggcgggccggcacctgaagcgg
accacgctggagctgggcggcaagtcggccgcggtgctgctgcccgacgccgagctcgag
cgcgcgctgccggtggtgctgcgcatggcggtggccaacagcggccaggcctgcgtgagc
cagtcgcgcctgatcgtgccgcgccagcggctggccgaggccgagcaggcgctggccgcg
ctggcgcaggcctggccgcagggcgatcccctcgacgccgcgacccggctggggccgctg
gccaacgcgcgccagttcgaacgcgtcaacgccctggtgagccgggcgctgcagcagggc
gcgcgcctggtggccggcggccccggccgtcccgcgggccaggcgcgcggctggcacgtg
ccggtgacgatcctgtccgacgtcacgccggacatggagctggcgcaggaggaagtgttc
ggcccggtgctggccctcatgccgtacgacgacgaggccagggcgctggcgctggccaat
tccacccgctatgggctgtcgggcgcggtgtggtcggccgacgccgcgcgcgccgccgcc
ttcgcgcggcgcatgaagaccggccaggtcatcatcaacggcgccgaccagaacctggcc
acgccgttcggcggacgcggcgcgtccggagtgggccgcgaaaacggacgcttcggcatc
gaggagtgcctgacctggcaggcgctgcacggggcgccgtag

DBGET integrated database retrieval system