KEGG   Bordetella bronchiseptica MO149: BN115_0996Help
Entry
BN115_0996        CDS       T02295                                 

Gene name
pepM
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bbm  Bordetella bronchiseptica MO149
Pathway
bbm00440  Phosphonate and phosphinate metabolism
bbm01100  Metabolic pathways
bbm01120  Microbial metabolism in diverse environments
bbm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bbm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BN115_0996 (pepM)
Enzymes [BR:bbm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BN115_0996 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: CCJ57752
LinkDB All DBs
Position
1081584..1082456
Genome map
AA seq 290 aa AA seqDB search
MTKNRSLRAALESGQLFTAMAAHNPLAARLAEEAGFGGIWGSGFELSASYAVPDANILSM
GTHLEMMRAIAATVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSL
RAEGRQELVRIEEFQGKVAAAAAARKDPDFVVIARVEALIAGQGQDEAIRRGLAYEEAGA
DAILIHSKQKTPDEILAFIAAWPGRKPLVLVPTAYPQLGERDIAALGKVGVVIYGNHAIR
AAVGAMREVFAQIRRDQGIGQADRGLPTVKEIIALQGDAHMREIEARYLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagaatcgatccctacgcgccgcgctcgaaagcggccagctcttcacggccatg
gccgcgcacaatcccctggcggccaggctggccgaggaggccggattcggcggcatctgg
ggcagcggcttcgagctgtcggccagctacgccgtgccggacgccaacattctttccatg
ggcacgcacctggaaatgatgcgcgccatcgccgcgaccgtgtcgatcccgctgatcgcc
gacatcgataccggcttcggcaatgcggtcaacgtgcattacgtggtgccgcagtacgag
gccgcgggcgcttcggccatcgtcatggaggacaagacctttcccaaggacaccagcctg
cgcgccgagggccgccaggaactggtgcgcatcgaggagttccagggcaaggtcgccgcc
gccgcggccgcgcgcaaggaccccgacttcgtcgtgatcgcgcgggtcgaggcgctgatc
gcggggcagggccaggacgaggccatccggcgcggcctggcctacgaggaagccggcgcg
gacgccattctcatccattccaagcagaagacgcccgacgagatcctggccttcatcgcc
gcgtggccgggccgcaagcccctggtgctggtgcccaccgcgtacccgcagctgggcgag
cgggatatcgccgcgctgggcaaggtgggcgtggtcatctacggcaaccacgccatccgc
gccgccgtgggcgccatgcgcgaggtcttcgcgcagatccgccgcgaccagggcatcggc
caggccgatcgcggcctgcccacggtcaaggagatcatcgccctgcagggcgatgcgcac
atgcgcgagatcgaggcccgctacctgaagtag

DBGET integrated database retrieval system